DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and Foxe1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:386 Identity:112/386 - (29%)
Similarity:146/386 - (37%) Gaps:128/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQN 225
            ||.....|.:...||..|.    |.....:.||.|       :|.....|||||||:||.|||.:
Mouse    17 AAVKEERGEAAAAGAGVPA----EAAGRGAGGRRR-------KRPLQRGKPPYSYIALIAMAIAH 70

  Fly   226 NPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDS 290
            .|.|.|||..||:||.:.|||||.|.::|||||||:|:.||||:||||...:||||::|.|.|::
Mouse    71 APERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNA 135

  Fly   291 GNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQH 355
            .:|||:|.:|||:||||               .|.| :|.|.        :||            
Mouse   136 EDMFESGSFLRRRKRFK---------------RSDL-STYPA--------YMH------------ 164

  Fly   356 HKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMA 420
                                 ||.|.|...|.|..     |..||.                  |
Mouse   165 ---------------------DAAAAAAAAAAAIF-----PGAVPA------------------A 185

  Fly   421 NRCHPSLITDYHSSMHPLKQEPSGYTP--SSHPFSINRLLP-----------------------T 460
            ...:|..:  |.....||...|..|.|  |..|..:..|:|                       .
Mouse   186 RPAYPGAV--YAGYAPPLAAPPPVYYPAASPGPCRVFGLVPERPLSPDLGPAPSAAGGSCAFAAA 248

  Fly   461 ESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLGYHAPAGTTSLXHHQYPLAXGR 521
            ...|....:..:...|...::|...:.|..|.|..|       |.|.:|.    :..| ||
Mouse   249 AGAAGTGSFQPAVCTGARPVNPAAYAAAYAGPDGAY-------PQGASSAL---FAAAAGR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 11/47 (23%)
FH 210..298 CDD:214627 53/87 (61%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53 9/42 (21%)
FH 55..143 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.