DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxq1a

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001230273.1 Gene:foxq1a / 100537750 ZFINID:ZDB-GENE-070424-74 Length:312 Species:Danio rerio


Alignment Length:173 Identity:72/173 - (41%)
Similarity:103/173 - (59%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SGTYGAMP-PGSREMETGSP-NSLGRSRVDKPTTYRRSYT-HAKPPYSYISLITMAIQNNPTRML 231
            |...|::| |.|.|.|.||. :.:..|......|..:.|| ..|||||||:||.|||:::.:..|
Zfish    45 SDAEGSIPSPVSAEEELGSDGDCVAHSPAPVADTKGKPYTRRPKPPYSYIALIAMAIRDSNSGRL 109

  Fly   232 TLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKP-GKGSFWTLHPDSGNMFE 295
            ||:||..::|..|||:|.:...|:||:||:||.||||:|:.|.|.:| ||.::|.|:|.|...|.
Zfish   110 TLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDNYWMLNPHSEYTFA 174

  Fly   296 NGCYLRRQKRFKDE---KKEAIRQLHKSPSHSSLEATSP--GK 333
            :|.:.||:||...:   :.|...|.|...|:.|: ||.|  ||
Zfish   175 DGVFRRRRKRISKKTGREPEGPVQTHALDSNDSI-ATPPSSGK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 13/41 (32%)
FH 210..298 CDD:214627 44/88 (50%)
foxq1aNP_001230273.1 FH 88..177 CDD:214627 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.