DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:306 Identity:99/306 - (32%)
Similarity:137/306 - (44%) Gaps:79/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SPLGNMGGCMAMSAASMSAAGLSGTYGAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPP 212
            |.:|:.|        .:|.:.||||..:. ..|.|.|.|:......:..|.    :.|....|||
 Frog    48 SEIGDSG--------VLSPSKLSGTENSC-HSSEEKEGGTSKDSLHTTPDS----KASRAFLKPP 99

  Fly   213 YSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDK 277
            ||||:||||||..:|.|.||||.|..||...||:|:.....|||||||:||.||||:||||.|..
 Frog   100 YSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGN 164

  Fly   278 PGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQ-------LHKSPSHSSLEATSP---- 331
            ||||::|||.|.|.:||:||.:|||:||||...:|.|:.       ||....:|:.:..:|    
 Frog   165 PGKGNYWTLDPASKDMFDNGSFLRRRKRFKRHHQELIKDGFLMYNPLHYITPYSAPQTQTPVICM 229

  Fly   332 ------GKKDH-----------------------EDSHHMHHHHHSRLDHHQHHKEAGGASIAGV 367
                  ...:|                       :|:||...||.              .|.:..
 Frog   230 AIPQNLAMPNHLAPYPHKIKVPCPDQGVNRVFKAQDNHHTASHHK--------------CSFSIE 280

  Fly   368 NVLSAAHSKDAE-ALAMLHAN---------AELCLSQQPQHVPTHH 403
            |::  ...|:.| :|...:.|         :..||.....|:.:.|
 Frog   281 NIM--GEPKEPEKSLKSFNQNWNYNHLLQSSSACLLPSGSHITSAH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 14/60 (23%)
FH 210..298 CDD:214627 55/87 (63%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.