DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxg1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:345 Identity:99/345 - (28%)
Similarity:140/345 - (40%) Gaps:106/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDL 243
            |.::.|.|           |....:::..:.|||:||.:||.|||:.:|.:.|||:.||:|||..
 Frog   104 GGKDGENG-----------KEGGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKN 157

  Fly   244 FPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGC--YLRRQ--- 303
            ||:||:|:|.|||||||:||.|.||||:||..|.||||::|.|.|.|.::|..|.  .|||:   
 Frog   158 FPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTT 222

  Fly   304 KRFKDEKKEAIR-----------------------QLHKSPSHSSLEATSPGKKDHEDSHHMHHH 345
            .|.|...|...|                       .||...:.|:|...  |......||.|.: 
 Frog   223 SRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSALSYN--GTTSAYPSHPMPY- 284

  Fly   346 HHSRLDHHQHHKEAGGASIAGVNVLSAAHS-KDAEALAMLH-ANAELCLSQQPQHVPTHHHHQHH 408
                            :|:...|.|.:.|| ..:..|::.. .|.|         :|...||   
 Frog   285 ----------------SSVLTQNSLGSNHSFSTSNGLSVDRLVNGE---------IPYATHH--- 321

  Fly   409 QLQQEELSAMM-------------ANRC-----------------HPSLITDYHSSM--HPLKQE 441
             |....|:|.:             .|.|                 |||:.:...:||  ......
 Frog   322 -LTAAALAASVPCGLPVPCSGTYSLNPCSVNLLAGQTGYFFPHVPHPSITSQSSTSMAARAASSS 385

  Fly   442 PSGYTPSSHPF-SINRLLPT 460
            .|...||:.|. |:...||:
 Frog   386 TSPQAPSTLPCESLRPALPS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/29 (14%)
FH 210..298 CDD:214627 51/87 (59%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.