DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxb1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001107970.1 Gene:foxb1 / 100125219 XenbaseID:XB-GENE-1018255 Length:322 Species:Xenopus tropicalis


Alignment Length:335 Identity:108/335 - (32%)
Similarity:151/335 - (45%) Gaps:113/335 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263
            |...|.:|:..|||||||||..||||::..:||.|||||:||||.||:||:|.||||||:||:||
 Frog     2 PRPGRNTYSDQKPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLS 66

  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEA 328
            |||||:||||.||:|||||||.|||..|:|||||.:|||:||||..|.:     |.:|       
 Frog    67 FNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVMKSD-----HLAP------- 119

  Fly   329 TSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLS 393
                                                          ||.::|...|...|:|   
 Frog   120 ----------------------------------------------SKASDAAQYLQQQAKL--- 135

  Fly   394 QQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLL 458
                                .|||:.|:..|...::.|:..:    .:.|.:   .|||:|..::
 Frog   136 --------------------RLSALAASGTHLPQMSTYNLGV----SQTSSF---KHPFAIENII 173

  Fly   459 PTESKADIKMYDMSQYAGYNALSPLTNSHAALGQ-DSYYQSLGYHAPAGTTSLXHHQY------- 515
            ..|       |.|.....::.:.|:..::....| .:...|:|...|        |.|       
 Frog   174 ARE-------YKMPGGLAFSTMQPMPAAYPLHNQLTTVGSSIGTGWP--------HMYSSSMLDT 223

  Fly   516 --PLAXGRAE 523
              |:: |.::
 Frog   224 TTPISMGNSD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/9 (33%)
FH 210..298 CDD:214627 65/87 (75%)
foxb1NP_001107970.1 FH 13..101 CDD:214627 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.