DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxf2

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:410 Identity:117/410 - (28%)
Similarity:177/410 - (43%) Gaps:108/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SAASMSAAGLSGTY--GAMPPGSREMETGSPNSLGRSRVDKPTT-YRRSYTHAKPPYSYISLITM 221
            |||.:.....:||.  ..|...|..|:|.|.:| ..|:..||.: .||.   .|||||||:||.|
 Frog    13 SAAPIRTNPATGTLQSALMSQQSTAMDTTSSSS-SSSKNKKPNSGLRRP---EKPPYSYIALIVM 73

  Fly   222 AIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTL 286
            |||::||:.|||||||||:...|||:|.:.|.|:||:||:||.|:||:|:|:...:||||.:||:
 Frog    74 AIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTI 138

  Fly   287 HPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKS-----------PSHSSLEATSPGKKDHEDSH 340
            .|.|..|||.|.:.||.:.|: .|.:|::.:::.           |.....:|.......|.:.:
 Frog   139 DPASEFMFEEGSFRRRPRGFR-RKCQALKPMYRMMNGIGFSTSILPQGFDFQAPPASLTCHSNGY 202

  Fly   341 HMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHANAELCLSQQPQHVPTHHHH 405
            ::....:|.         ||     |.:.|:..|                       |||     
 Frog   203 NLDMMSNSM---------AG-----GYDGLAGGH-----------------------HVP----- 225

  Fly   406 QHHQLQQEELSAMMANRCHPSLITDY--HSSMHPLKQEP---------SGYT-PSSH-------P 451
               .:.....|..||: |..|...||  .||..|:...|         |.|| |::|       |
 Frog   226 ---HMSPNPGSTYMAS-CPVSSSGDYGPDSSSSPVPSSPAMASAMECHSPYTSPTAHWASSGASP 286

  Fly   452 FSINRLLPTESKAD------IKMYDMSQYAGYNALSPLTNSHAALGQDSYYQS------------ 498
            :...:.:|..:.|.      :..|.:.|  .|...:|..:....|.:..::.|            
 Frog   287 YLKQQPMPPSNGASAGIHTGVSPYSLEQ--SYLHQNPREDLSVGLPRYQHHSSPVCDRKDFVLNF 349

  Fly   499 ---LGYHAPAGTTSLXHHQY 515
               ..:| |:.|:|..||.:
 Frog   350 NGISSFH-PSATSSYYHHHH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 16/51 (31%)
FH 210..298 CDD:214627 52/87 (60%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.