DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxe1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:399 Identity:117/399 - (29%)
Similarity:179/399 - (44%) Gaps:87/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AMSAASMSAAGLSGTYGAMPPGSREMETGSPNSL---GRSRVDKPTTYRRS--YTHAKPPYSYIS 217
            |..|:...|:||:     ||....|.:.....|:   |....|.|...||.  ....|||||||:
 Frog    14 AAGASLQQASGLT-----MPVVKVEKDPAPEASMSNGGSEGEDTPKGRRRKRPLQKGKPPYSYIA 73

  Fly   218 LITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGS 282
            ||.|||.|:..|.|||..||:||.:.|||||.|.::|||||||:|:.||||:||||.|.:||||:
 Frog    74 LIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGN 138

  Fly   283 FWTLHPDSGNMFENGCYLRRQKRFK-DEKKEAIRQLHKSPSHSSLE---ATSPGKKDHEDSHHMH 343
            :|.|.|::.:||::|.:|||:|||| .:.......:|.:...|.|:   ||.|.           
 Frog   139 YWALDPNAEDMFDSGSFLRRRKRFKRTDLTTYPAYIHDTSMFSPLQVARATYPN----------- 192

  Fly   344 HHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLH--ANAELCLSQQPQ--------- 397
                               ::.....:|.::|:.....:.::  :::....|.||:         
 Frog   193 -------------------TVYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSINTLIG 238

  Fly   398 HVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHS-----SMHPLKQEPSGYT-PSSH------ 450
            |..:.|..|.::....|:::..::.|:....| |.|     :|.|....|..|: |:||      
 Frog   239 HSGSEHAQQPNRSISPEVNSTSSSSCNYGGST-YSSQAGSGTMLPRSTNPYSYSVPNSHLQMNQS 302

  Fly   451 --PFSINRL--------LPTESKADIKMYDM------SQYAG---YNALSPLTNSHAALGQDSYY 496
              |.|..:|        :||....:....|.      .||..   ||:...|..::|.|...:|.
 Frog   303 SYPHSNAQLFGSASRLPMPTSPPMNSDAVDFYGRMSPGQYTSLTTYNSNGQLGGTNAYLRHATYS 367

  Fly   497 QSLGYHAPA 505
            .::....||
 Frog   368 GNMERFVPA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 14/55 (25%)
FH 210..298 CDD:214627 53/87 (61%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.