DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and foxd7

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:378 Identity:111/378 - (29%)
Similarity:151/378 - (39%) Gaps:125/378 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLF 244
            :::.|...|:|:..|...|.::       .|||||||:||||||..:|.:.||||||..||...|
Zfish    41 NKDEENHVPSSICPSSSSKSSS-------VKPPYSYIALITMAILQSPKKRLTLSEICDFISHRF 98

  Fly   245 PFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDE 309
            .:||:....|||||||:||.||||||:||.|..||||::|||.|:|.:|||||.:|||:||||  
Zfish    99 VYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFK-- 161

  Fly   310 KKEAIRQLHKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAH 374
                                                       .||.|       .||       
Zfish   162 -------------------------------------------RQHFK-------FGV------- 169

  Fly   375 SKDAEALAMLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLK 439
            .|| :||             ||...|...:..:         .:.|:..|...:..|..|.|   
Zfish   170 FKD-QAL-------------QPSGFPNLSYGAY---------GLSASCAHLPALDVYPYSFH--- 208

  Fly   440 QEPSGYTPSSHPFSINRLLP------TESKADIKMYDMSQYAGYNALSPLTNSHA-ALGQDS-YY 496
             :..|..|      :..:||      :.:....|.:..||..   |:.|:|...| |:...| |.
Zfish   209 -QHIGVPP------VGSILPALSTLFSRNSVAAKSFPQSQTV---AIEPVTPGIACAMAPTSPYA 263

  Fly   497 QSLGYHAPAGTTSLXHHQYPLAXGRAEQMLRSQQQQHLQQQHQQHQQQQQQHQ 549
            .|.....|.|...:.:.||              :.|.||..| .|.....:|:
Zfish   264 SSAALFNPVGFPRMLNFQY--------------EYQKLQNAH-SHVDLSTKHR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 5/28 (18%)
FH 210..298 CDD:214627 56/87 (64%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 51/82 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.