DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mIF2 and AT3G53370

DIOPT Version :10

Sequence 1:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_566985.1 Gene:AT3G53370 / 824505 AraportID:AT3G53370 Length:76 Species:Arabidopsis thaliana


Alignment Length:77 Identity:19/77 - (24%)
Similarity:33/77 - (42%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LDTPGHAAFSAMRARGAVATDIIVLVVAAEDGVMAQTREVIQLAKEAQVPIIVALNKIDKPEANI 279
            :|....|..:|..|:|.....|::|||.....|......|:.:..:..:|     .:..||.:. 
plant     1 MDGEDFAGKAAAEAKGLNPGLIVLLVVGGPLLVFLIANYVLYVYAQKNLP-----PRKKKPVSK- 59

  Fly   280 EKSKRELAQMGL 291
            :|.|||..:.|:
plant    60 KKLKREKLKQGV 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mIF2NP_651621.2 InfB 159..688 CDD:440298 19/77 (25%)
AT3G53370NP_566985.1 S1FA 17..76 CDD:282535 14/61 (23%)

Return to query results.
Submit another query.