DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mIF2 and CG2017

DIOPT Version :9

Sequence 1:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_649603.3 Gene:CG2017 / 40733 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster


Alignment Length:409 Identity:85/409 - (20%)
Similarity:139/409 - (33%) Gaps:155/409 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 ADLKIIQEIAKKLGAKTRVVATPEETNADEQKERDVAPRPPAAPELLQPRPP-------VVTVMG 169
            |.|..::::|..|||.|.|:           :.:.:|.|...|..|::..|.       .|.|:|
  Fly   169 ASLTTLKQMAHSLGASTSVL-----------RRKTIAARRAVAEVLVRKIPDDQHNIEVRVAVLG 222

  Fly   170 HVDHGKTTL--------LDSLRGA----------DVAAGEAGGITQHIGAF-------------T 203
            ..|.||:||        ||:..|.          ::.:|....|:.....|             .
  Fly   223 GADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGNVVNYKYNEM 287

  Fly   204 VTLE-----NGERVTFLDTPGHAAF--SAMRARGAVATDIIVLVVAAEDGVMAQTREVIQLAKEA 261
            :|.|     :.:.|||:|..||..:  :.::|....:....:|||:|..|....|.|.:.:.:..
  Fly   288 MTAEEISDRSSKLVTFMDLAGHRRYMRTTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRAL 352

  Fly   262 QVPIIVALNKID--KPEANIEKSKRELAQMGL------------ALEEHGGDV--QVIPI---SA 307
            .:|..|.:.|.|  .|:|.:::....|..:|.            |:......:  .::||   |.
  Fly   353 DMPFFVLVTKTDITSPDATVQELCNLLTTIGCRKVPFVVTNTDEAISAGSNQISENIVPIFCVSN 417

  Fly   308 LKGTNLELLAE------------------------------AVSTQATLMGLKADPTG-LVEGIV 341
            :.||.|.|:.:                              .||....::|      | ||:|::
  Fly   418 VTGTGLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVG------GLLVQGVL 476

  Fly   342 VES---KTDP--------------RRGKLSTAIVSRG--------------TLRKGSVLLSGLAH 375
            .|:   |..|              .|.|....:|..|              |||.|.|||..:.:
  Fly   477 TENMAMKIGPLPDGSFHPVTVNTIHRNKAPCRVVRAGQSASLSFSMDQDVPTLRSGMVLLGDIGN 541

  Fly   376 ------------AKVRGLF 382
                        |||..||
  Fly   542 SLDEPYGTFFFQAKVSVLF 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mIF2NP_651621.2 InfB 158..689 CDD:223606 73/363 (20%)
IF2_eIF5B 163..327 CDD:206674 48/257 (19%)
IF2_mtIF2_II 336..431 CDD:293903 22/90 (24%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 85/409 (21%)
GTPBP1_like 217..436 CDD:206728 46/218 (21%)
GTPBP_II 450..536 CDD:293895 19/91 (21%)
GTPBP_III 547..634 CDD:294007 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.