DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mIF2 and waw

DIOPT Version :9

Sequence 1:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001027089.1 Gene:waw / 3771960 FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster


Alignment Length:291 Identity:81/291 - (27%)
Similarity:125/291 - (42%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IAKKLGAKTRVVATPEETNADEQKERDVAPRPPAAPELLQ--PRPPV-----VTVMGHVDHGKTT 177
            :|:......|.::|..:...:.::        |:..:||:  ...||     .:::.||||||:|
  Fly    58 VARSKSLLVRNLSTTNQVKGETEE--------PSQADLLREFAHMPVERIRNFSIIAHVDHGKST 114

  Fly   178 LLDSLRGADVAAGEAGGITQHIGAFTVTLENGERV------------------TFLDTPGHAAFS 224
            |.|.|.....|....||..|.:....|..|.|..|                  ..:|||||..||
  Fly   115 LADRLLELTGAIARNGGQHQVLDNLQVERERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFS 179

  Fly   225 AMRARGAVATDIIVLVVAAEDGVMAQTREVIQLAKEAQVPIIVALNKIDKPEANIEKSKRELAQM 289
            ...:|...|.|.:||:|.|..||.|||.....|||:.|:.::..|||||...||.::..::|..:
  Fly   180 NEVSRSLAACDGVVLLVDACHGVQAQTVANYHLAKQRQLAVVPVLNKIDIKHANPDQVCQDLKLL 244

  Fly   290 -GLALEEHGGDVQVIPISALKGTNLELLAEAVSTQATLMGLKADPTGLVE------GIVVESKTD 347
             |:..:|      |:.:||..||.:..:.|.|        ::..|...|:      .::.:|..|
  Fly   245 FGIDPDE------VLRVSAKLGTGVSEVLERV--------IETVPPPQVQRDSDFRALIFDSWFD 295

  Fly   348 PRRGKLSTAIVSRGTLRKGSVLLSGLAHAKV 378
            ..||.|:...|..|.|.:...:.| ||..||
  Fly   296 KYRGALNLIYVLNGKLEQNQDIQS-LATKKV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mIF2NP_651621.2 InfB 158..689 CDD:223606 76/253 (30%)
IF2_eIF5B 163..327 CDD:206674 60/187 (32%)
IF2_mtIF2_II 336..431 CDD:293903 14/49 (29%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
wawNP_001027089.1 PRK05433 94..695 CDD:235462 75/247 (30%)
LepA 100..277 CDD:206677 59/190 (31%)
EF4_II 285..370 CDD:293900 13/42 (31%)
EF4_III 386..461 CDD:293917
lepA_C 502..581 CDD:239680
LepA_C 589..695 CDD:283959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.