DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mIF2 and Dgp-1

DIOPT Version :9

Sequence 1:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_611302.1 Gene:Dgp-1 / 37080 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster


Alignment Length:273 Identity:65/273 - (23%)
Similarity:105/273 - (38%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VTVMGHVDHGKTTL--------LDSLRG----------ADVAAGEAGGITQHIGAF--------- 202
            |.|:|:||.||:||        ||:.||          .::.:|....:...|..|         
  Fly   146 VAVVGNVDAGKSTLLGVLTHGELDNGRGHARQRLFRHKHEIESGRTSSVGNDILGFDGVGNVVNK 210

  Fly   203 --------TVTLENGERV-TFLDTPGHAAFSAMRARGAV--ATDIIVLVVAAEDGVMAQTREVIQ 256
                    ....||..:| ||:|..||..:......|..  |.|..:|::.|..|::..|:|.:.
  Fly   211 PDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIGANAGIIGMTKEHLG 275

  Fly   257 LAKEAQVPIIVALNKIDKPEANIEKSKREL----------AQMGLALEEHGGDV----------- 300
            ||....||:.|.:.|||...||:.:...:|          .::.:.:..|...|           
  Fly   276 LALALAVPVFVVVTKIDMCPANVLQENMKLLFKMLKSQGCRKVPVVVRSHDDVVLSATNFVSERL 340

  Fly   301 -QVIPISALKGTNLELLAEAVSTQATLMGLKADPTGLVEGIVVESKTD-----PRRGKLSTAIVS 359
             .:..:|.:.|.|||||...::..:|.|     |..  |.:..|.:.|     |..|.:.:....
  Fly   341 CPIFQVSNVTGDNLELLKMFLNLLSTRM-----PGS--ESLPAEFQIDDVYAVPGVGTVVSGTCL 398

  Fly   360 RGTLRKGSVLLSG 372
            :||:|....|:.|
  Fly   399 QGTIRLNDCLMLG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mIF2NP_651621.2 InfB 158..689 CDD:223606 65/273 (24%)
IF2_eIF5B 163..327 CDD:206674 53/221 (24%)
IF2_mtIF2_II 336..431 CDD:293903 10/42 (24%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 65/273 (24%)
GTPBP1_like 145..367 CDD:206728 52/220 (24%)
GTPBP_II 376..462 CDD:293895 9/36 (25%)
GTPBP_III 468..553 CDD:294007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.