DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mIF2 and HBS1

DIOPT Version :9

Sequence 1:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001286906.1 Gene:HBS1 / 117365 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster


Alignment Length:482 Identity:105/482 - (21%)
Similarity:170/482 - (35%) Gaps:124/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AARLKRRKTAEEKKSPRIIEYSPKKFQT--------AGGGASDIWRHMTVAQLAKELERSLDDV- 92
            ||..|.|:.:|..:.|::.|....|..:        .|...|:.....|..:...::::.||:: 
  Fly    75 AAFAKARRDSESFQMPQLDEIEQAKLSSCVDEVRSVVGDAVSERRIVETSMKFDYDMQKILDEIL 139

  Fly    93 -QEAMLYVKGADNIEPAFKLADLKIIQEIAKKLGAKTRVVATPEETNADEQKERDV---APRPPA 153
             :|.....|.|.|   ..|.....::.:...|      .|.||....:.::..|..   :|:.|:
  Fly   140 NEETNKSAKPAVN---KMKAPAAPVLPKTVSK------TVPTPPPKISLKEPRRGFEIPSPKVPS 195

  Fly   154 APELLQPRPPV-------------------------------------------VTVMGHVDHGK 175
            :|.:.....||                                           :.|:||||.||
  Fly   196 SPVVSGRNTPVDISAGDDISRSSATVFKVSKEQAVRNARQLYEKERADQKSHIHMIVIGHVDAGK 260

  Fly   176 TTLLDSL--RGADVA---------------------------AGE--AGGITQHIGAFTVTLENG 209
            :||:..|  ...:|:                           .||  |.|||..:|...:..:. 
  Fly   261 STLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETGEERARGITMDVGQSRIETKT- 324

  Fly   210 ERVTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG-------VMAQTREVIQLAKEAQV-PII 266
            :.||.||.|||..|......||...|:.:|||.|..|       :..||||...|.:...| .:.
  Fly   325 KIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQTREHAILVRSLGVNQLG 389

  Fly   267 VALNKIDKPEANIEKSKRELAQMGLALEEHG---GDVQVIPISALKGTNLELLAEAVSTQATLMG 328
            |.:||:|....:.::....:.::...|:..|   .||...|.|.|.|.||...|:..:......|
  Fly   390 VVINKLDTVGWSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTGENLTKKAQEPALTNWYSG 454

  Fly   329 LKADPTGLVEGIVVESKTDPRRGKLSTAIVSRGTLRKGS-VLLSGLAHAKVRGLFDH--NGQPLS 390
            ...  ..::|...:..:...|..::|.:.:.:||   || ..:||.....|..|.|.  .|....
  Fly   455 RHL--LDVIENFKIPERAIDRPLRMSVSDIYKGT---GSGFCISGRVETGVLCLNDKVLVGASRE 514

  Fly   391 EAPPGTPVEILGWRELP----LAGDLI 413
            :|    .|:.|...|.|    .|||.:
  Fly   515 QA----QVKSLTMNEFPQTCVFAGDQV 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mIF2NP_651621.2 InfB 158..689 CDD:223606 79/348 (23%)
IF2_eIF5B 163..327 CDD:206674 57/248 (23%)
IF2_mtIF2_II 336..431 CDD:293903 21/85 (25%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079 10/61 (16%)
TEF1 241..669 CDD:227581 77/307 (25%)
EF1_alpha 249..468 CDD:206670 57/221 (26%)
HBS1-like_II 474..557 CDD:293912 19/71 (27%)
HBS1_C_III 561..669 CDD:294008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.