DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and HAM2

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_196536.1 Gene:HAM2 / 830834 AraportID:AT5G09740 Length:445 Species:Arabidopsis thaliana


Alignment Length:311 Identity:116/311 - (37%)
Similarity:176/311 - (56%) Gaps:21/311 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RQRQETID------NEKSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYV 176
            |.::..||      :|:.|....:|..:...::||..::.|:|||||...||:|...:....::.
plant   140 RHQKRKIDETHIEGHEELDAASLREHEEFTKVKNISTIELGKYEIETWYFSPFPPEYNDCVKLFF 204

  Fly   177 CEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENK 241
            |||||.:|..::....|:..|..:.|||..:||...:.::||||.|.::|.|.||.::||||::|
plant   205 CEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYAQNLCYLAKLFLDHK 269

  Fly   242 KILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKLLIDLSYEI 305
            .:.|....||||:||..|..|.|..|||::|| :....||.|||.||.|.||||||.||..|||:
plant   270 TLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEEAYNLACILTLPSYQRKGYGKFLIAFSYEL 334

  Fly   306 SRREACIGGPKKPLSKVARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFREEDIISTLEF 370
            |::|..:|.|::|||.:..|.|..||..:||.:|:.|...  ::|:|||..|..:.|||:|||:.
plant   335 SKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKHKGN--ISIKELSDVTAIKAEDILSTLQS 397

  Fly   371 MGMTKYYKVDHIMFYTTSSIIEDRRGLAQFKKPR----LTIHRNRLSWKTP 417
            :.:.:|.|..|:       |..|.:.|.:..|..    |.:..::|.| ||
plant   398 LELIQYRKGQHV-------ICADPKVLDRHLKAAGRGGLDVDASKLIW-TP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 105/265 (40%)
MOZ_SAS 202..378 CDD:280097 80/176 (45%)
HAM2NP_196536.1 PLN00104 1..445 CDD:215056 116/311 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10615
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.