DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and Kat6b

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_038949635.1 Gene:Kat6b / 688634 RGDID:1566399 Length:2039 Species:Rattus norvegicus


Alignment Length:274 Identity:106/274 - (38%)
Similarity:168/274 - (61%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SSNVDDRQRQETIDNEKSDVQKEKED---AKVKVIRNIEK-------VQFGRYEIETTSSSPYPV 166
            |.:|:....::.:..|..||.|:.::   .|::....:|.       ::||:|||:|..|||||.
  Rat   676 SMDVNVMGNKDLVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQ 740

  Fly   167 INDKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLC 231
            ...:...:|:||||||||..:.....|...|....||.:.:||:.::.::||||:..::|||.||
  Rat   741 EYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLC 805

  Fly   232 LMSKLFLENKKILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYG 295
            |::||||::|.:.|....||||:|...|:.|.|..|||::|| .....|::||:::|.:.|:|:|
  Rat   806 LLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFG 870

  Fly   296 KLLIDLSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLN-LLRHHSSPDLVTIEELSKATGF 359
            :.|||.||.:||||...|.|:||||.:.||.||:||..::|. |.|||...  ::|:.:|:|||.
  Rat   871 RFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYLYRHHERH--ISIKAISRATGM 933

  Fly   360 REEDIISTLEFMGM 373
            ...||.:||:::.|
  Rat   934 CPHDIATTLQYLHM 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 103/256 (40%)
MOZ_SAS 202..378 CDD:280097 76/174 (44%)
Kat6bXP_038949635.1 H15 94..168 CDD:197772
PHD1_MOZ_MORF 213..270 CDD:277090
PHD2_KAT6A_6B 272..318 CDD:277002
PLN00104 <721..989 CDD:215056 98/229 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.