DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1894 and Samd1

DIOPT Version :9

Sequence 1:	NP_651620.1	Gene:	CG1894 / 43378	FlyBaseID:	FBgn0039585	Length:	421	Species:	Drosophila melanogaster
Sequence 2:	NP_001074884.1	Gene:	Samd1 / 666704	MGIID:	2142433	Length:	519	Species:	Mus musculus

Alignment Length:	124	Identity:	25/124 - (20%)
Similarity:	42/124 - (33%)	Gaps:	41/124 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    16 LGDQDGISSKLPDIPRALQLTNAKESSATRGLGQSASKSEMGKSQLQNDSSLQKNIQETKTITGS 80
            ||...|.|.:|                 |||..|...:.|..:.:|
Mouse   239 LGGSGGASGRL-----------------TRGRVQGLLEEEAARGRL------------------- 267

  Fly    81 CIEAQRIG--ATPKKQLEGVKEPNMISLLHTNASSNVDDRQRQETIDNEKSDVQKEKED 137
              |..|:|  |.|:....| :.|...|.....:....::|..::..::|..|.::|:||
Mouse   268 --ERTRLGALALPRGDRPG-RAPPAASARAARSKRGGEERVFEKEEEDEDEDEEEEEED 323

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1894	NP_651620.1	NAT_SF	130..395	CDD:302625	4/8 (50%)
CG1894	NP_651620.1	MOZ_SAS	202..378	CDD:280097
Samd1	NP_001074884.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	87..232
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	261..381		16/85 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	417..439
		SAM_Atherin-like	440..508	CDD:188982
		SAM	440..506	CDD:197735
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5027
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900