DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and kat7

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_012827190.1 Gene:kat7 / 548673 XenbaseID:XB-GENE-488776 Length:617 Species:Xenopus tropicalis


Alignment Length:382 Identity:130/382 - (34%)
Similarity:206/382 - (53%) Gaps:20/382 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SASKSEMGKSQLQNDSSLQKNIQETKTITGSCIEAQRIGATPKKQLE----------GVKEPNMI 104
            |..:.|..:...::.:..::.::..:.:|.  :..:|.....|:|.|          ..:||   
 Frog   243 SHRQDENNRHATRHQAPTERQLRYKEKVTE--LRKKRNSGLTKEQKEKYMEHRQTYGDTREP--- 302

  Fly   105 SLLHTNASSNVDDRQRQETIDNEKSDVQKEKEDAKVKVIRN-IEKVQFGRYEIETTSSSPYPVIN 168
              |..|.:|..|....:........|::|.:...::....| |:.:.|||||::|...||||...
 Frog   303 --LLENLTSEYDLELFRRAQARASDDLEKLRLQGQITEGSNMIKTIIFGRYELDTWYHSPYPEEY 365

  Fly   169 DKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLM 233
            .:...:|:||||||||..:.....|:..|..:.|||..:|||.:|.::||||.|.::|||.|||:
 Frog   366 ARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLL 430

  Fly   234 SKLFLENKKILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKL 297
            :||||::|.:.|....||||::...|..|.|..|||::|| :.||.|::|||.:|.|||:||||:
 Frog   431 AKLFLDHKTLYYDVEPFLFYVMTEGDNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKM 495

  Fly   298 LIDLSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFREE 362
            |||.||.:|:.|..:|.|::|||.:..:.|.|||..:||..| |:.....::|:|:|:.|.....
 Frog   496 LIDFSYLLSKVEDKVGSPERPLSDLGLISYRSYWKEVLLRYL-HNFQGKEISIKEISQETAVNPV 559

  Fly   363 DIISTLEFMGMTKYYKVDHIMFYTTSSIIEDRRGLAQFKKPRLTIHRNRLSWKTPTG 419
            ||:|||:.:.|.||:|..|::......|.|.....|:......|:..:.|.|..|.|
 Frog   560 DIVSTLQALQMLKYWKGKHLVLKRQDLIDEWASKDAKRTNSNKTMDPSCLKWTPPKG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 111/266 (42%)
MOZ_SAS 202..378 CDD:280097 82/176 (47%)
kat7XP_012827190.1 zf-C2HC 184..212 CDD:366692
PLN00104 <323..615 CDD:215056 115/292 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.