DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and Tip60

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster


Alignment Length:318 Identity:123/318 - (38%)
Similarity:183/318 - (57%) Gaps:10/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LLHTNASSNVDDRQRQETIDNEKSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDK 170
            |:...|:.:.|..|..:|....:|......:|..|..::|:|.::.||:.|:....||||....:
  Fly   220 LISGAANDDGDGSQDGKTPTPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQ 284

  Fly   171 ATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSK 235
            ...||:|||||||...||....||..|..|.|||:.:|||..|..:|:||.|.::|.|.|||::|
  Fly   285 MPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAK 349

  Fly   236 LFLENKKILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKLLI 299
            |||::|.:.|.:..||||::...|..|.|..|||::|| :..:.|:.|||.:|||.|||||||||
  Fly   350 LFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLI 414

  Fly   300 DLSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLNL-LRHHSSPD----LVTIEELSKATGF 359
            :.|||:|:.|...|.|:||||.:..|.|.|||...:|.: :..:.|.|    .:||.::.:.|..
  Fly   415 EFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSI 479

  Fly   360 REEDIISTLEFMGMTKYYKVDHIMFYTTSSIIEDRRGLAQFKKPRLTIHRNRLSWKTP 417
            ::||:||||:.:.:..|||..:|:......|.:.||.:   .|.::.|....|.| ||
  Fly   480 KKEDVISTLQNLNLINYYKGQYIVCINRVIIEQHRRAM---DKRKIRIDSKCLHW-TP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 109/270 (40%)
MOZ_SAS 202..378 CDD:280097 79/181 (44%)
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553
Drf_FH1 84..>157 CDD:283903
PHA01732 139..>196 CDD:222828
NAT_SF 254..533 CDD:302625 114/282 (40%)
MOZ_SAS 316..500 CDD:280097 81/183 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10615
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.