DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and Kat7

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_851595.1 Gene:Kat7 / 303470 RGDID:727966 Length:612 Species:Rattus norvegicus


Alignment Length:423 Identity:141/423 - (33%)
Similarity:219/423 - (51%) Gaps:34/423 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NRSGDHLKYQPLGDQDGISSKLPDIPRALQLTNAKESS---ATRGLG----QSASKSEMGKSQLQ 62
            |.|.|..|.:.......|..::        |::.::.:   |||...    |...|.::.:.:.:
  Rat   215 NLSADECKVRAQSRDKQIEERM--------LSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKK 271

  Fly    63 NDSSLQKNIQETKTITGSCIEAQRIGATPKKQLEGVKEPNMISLLHTNASSNVDDRQRQETIDNE 127
            .:|.|.|. |:.|.:.    ..|..|.|.:..||.:.....:.|...        .|.:.:.|.|
  Rat   272 RNSGLSKE-QKEKYME----HRQTYGNTREPLLENLTSEYDLDLFRR--------AQARASEDLE 323

  Fly   128 KSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSY 192
            |..:|.:..:..    ..|:.:.|||||::|...||||....:...:|:||||||||..:.....
  Rat   324 KLRLQGQITEGS----NMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRR 384

  Fly   193 HLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCL 257
            |:..|..:.|||..:|||.:|.::||||.|.::|||.|||::||||::|.:.|....||||::..
  Rat   385 HMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTE 449

  Fly   258 KDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSK 321
            .|..|.|..|||::|| :.||.|::|||.:|.|||:||||:|||.||.:|:.|..:|.|::|||.
  Rat   450 ADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSD 514

  Fly   322 VARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFREEDIISTLEFMGMTKYYKVDHIMFYT 386
            :..:.|.|||..:||..| |:.....::|:|:|:.|.....||:|||:.:.|.||:|..|::...
  Rat   515 LGLISYRSYWKEVLLRYL-HNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKR 578

  Fly   387 TSSIIEDRRGLAQFKKPRLTIHRNRLSWKTPTG 419
            ...|.|.....|:......|:..:.|.|..|.|
  Rat   579 QDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKG 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 109/265 (41%)
MOZ_SAS 202..378 CDD:280097 82/176 (47%)
Kat7NP_851595.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..174
zf-C2HC 185..211 CDD:279824
NAT_SF 330..608 CDD:302625 112/282 (40%)
MOZ_SAS 394..572 CDD:280097 83/178 (47%)
acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:O95251 476..478 1/1 (100%)
acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:O95251 484..489 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.