DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1894 and Kat7

DIOPT Version :9

Sequence 1:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006533076.1 Gene:Kat7 / 217127 MGIID:2182799 Length:613 Species:Mus musculus


Alignment Length:423 Identity:141/423 - (33%)
Similarity:219/423 - (51%) Gaps:34/423 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NRSGDHLKYQPLGDQDGISSKLPDIPRALQLTNAKESS---ATRGLG----QSASKSEMGKSQLQ 62
            |.|.|..|.:.......|..::        |::.::.:   |||...    |...|.::.:.:.:
Mouse   216 NLSADECKVRAQSRDKQIEERM--------LSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKK 272

  Fly    63 NDSSLQKNIQETKTITGSCIEAQRIGATPKKQLEGVKEPNMISLLHTNASSNVDDRQRQETIDNE 127
            .:|.|.|. |:.|.:.    ..|..|.|.:..||.:.....:.|...        .|.:.:.|.|
Mouse   273 RNSGLSKE-QKEKYME----HRQTYGNTREPLLENLTSEYDLDLFRR--------AQARASEDLE 324

  Fly   128 KSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSY 192
            |..:|.:..:..    ..|:.:.|||||::|...||||....:...:|:||||||||..:.....
Mouse   325 KLRLQGQITEGS----NMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRR 385

  Fly   193 HLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCL 257
            |:..|..:.|||..:|||.:|.::||||.|.::|||.|||::||||::|.:.|....||||::..
Mouse   386 HMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTE 450

  Fly   258 KDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSK 321
            .|..|.|..|||::|| :.||.|::|||.:|.|||:||||:|||.||.:|:.|..:|.|::|||.
Mouse   451 ADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSD 515

  Fly   322 VARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFREEDIISTLEFMGMTKYYKVDHIMFYT 386
            :..:.|.|||..:||..| |:.....::|:|:|:.|.....||:|||:.:.|.||:|..|::...
Mouse   516 LGLISYRSYWKEVLLRYL-HNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKR 579

  Fly   387 TSSIIEDRRGLAQFKKPRLTIHRNRLSWKTPTG 419
            ...|.|.....|:......|:..:.|.|..|.|
Mouse   580 QDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKG 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 109/265 (41%)
MOZ_SAS 202..378 CDD:280097 82/176 (47%)
Kat7XP_006533076.1 Herpes_BLLF1 <29..>199 CDD:282904
zf-C2HC 186..214 CDD:366692
PLN00104 <326..611 CDD:215056 113/289 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.