Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121748.1 | Gene: | zgc:172120 / 799440 | ZFINID: | ZDB-GENE-080204-46 | Length: | 273 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 50/267 - (18%) |
---|---|---|---|
Similarity: | 90/267 - (33%) | Gaps: | 69/267 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LSWIIISELLLSAHCLKDLKIFVPE---AVLMGNAATLSCQY--DLEQAALYAVRW--------- 87
Fly 88 ---YFGQEEFYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLF 149
Fly 150 HTEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVC----TVGPSYPPANITWSINGNQIRRT 210
Fly 211 PLQRISQDTYEGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQCV-VTIRHMYHKVVAQRIGLNA 274
Fly 275 APPTTIS 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 22/89 (25%) |
Ig strand B | 67..76 | CDD:409353 | 3/10 (30%) | ||
CDR1 | 76..83 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 83..91 | CDD:409353 | 3/19 (16%) | ||
FR2 | 84..91 | CDD:409353 | 3/18 (17%) | ||
CDR2 | 94..108 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 94..99 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 102..104 | CDD:409353 | 0/1 (0%) | ||
FR3 | 109..143 | CDD:409353 | 7/33 (21%) | ||
Ig strand D | 117..121 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 123..127 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 136..144 | CDD:409353 | 4/7 (57%) | ||
zgc:172120 | NP_001121748.1 | IG_like | 23..127 | CDD:214653 | 25/110 (23%) |
Ig | 30..126 | CDD:299845 | 24/102 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |