Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001338090.3 | Gene: | LOC797620 / 797620 | -ID: | - | Length: | 268 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 39/205 - (19%) |
---|---|---|---|
Similarity: | 74/205 - (36%) | Gaps: | 45/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LSWIIISELLLSAHCLKDLKIFVPE---AVLMGNAATLSCQYDLE-QAALYAVRW---------- 87
Fly 88 -YFGQEEFYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHT 151
Fly 152 EIRSAHMQVIEL----PKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPL 212
Fly 213 QRISQDTYEG 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 16/87 (18%) |
Ig strand B | 67..76 | CDD:409353 | 4/8 (50%) | ||
CDR1 | 76..83 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 83..91 | CDD:409353 | 2/18 (11%) | ||
FR2 | 84..91 | CDD:409353 | 2/17 (12%) | ||
CDR2 | 94..108 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 94..99 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 102..104 | CDD:409353 | 0/1 (0%) | ||
FR3 | 109..143 | CDD:409353 | 6/33 (18%) | ||
Ig strand D | 117..121 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 123..127 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 136..144 | CDD:409353 | 4/7 (57%) | ||
LOC797620 | XP_001338090.3 | Ig | 36..119 | CDD:325142 | 16/95 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |