DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and zgc:153911

DIOPT Version :9

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001070783.1 Gene:zgc:153911 / 768172 ZFINID:ZDB-GENE-061013-174 Length:288 Species:Danio rerio


Alignment Length:200 Identity:44/200 - (22%)
Similarity:81/200 - (40%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLLSAHCLKDLKIFVPEAVLM---GNAATLSCQYDLEQA---ALYAVRW----------YFGQEE 93
            |||.|.|..:.:|.||.:.::   |....|.|.:.::.:   :...:.|          |:.:::
Zfish    11 LLLEASCFIEFEISVPRSPVIGFYGEELILPCTFPVDSSWDLSSTVITWQRGLDVVHSFYYSRDQ 75

  Fly    94 FYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHM 158
            ..|..|.....|.:|.     .::...:| |:.|..||:..:|.|.|.:|.::   .::.:|..:
Zfish    76 LDRQNPHYVSRTSLFI-----QEMQRGNA-SLKLDKVTQRDAGVYTCSISTNS---GSQKKSFAV 131

  Fly   159 QVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDTYEGS 223
            .:..| ..:|.:|......|||    .:.|....||...:.|.:..:.|.......:.|||..|.
Zfish   132 NIAAL-YSEPRLQFSMLTDGVN----LLVTSDGGYPSPTLQWLMENSDITNQTQTHLRQDTSTGL 191

  Fly   224 TTYSS 228
            ...||
Zfish   192 YIVSS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 Ig 66..142 CDD:416386 17/88 (19%)
Ig strand B 67..76 CDD:409353 2/8 (25%)
CDR1 76..83 CDD:409353 0/9 (0%)
Ig strand C 83..91 CDD:409353 2/17 (12%)
FR2 84..91 CDD:409353 2/16 (13%)
CDR2 94..108 CDD:409353 3/13 (23%)
Ig strand C' 94..99 CDD:409353 1/4 (25%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 8/33 (24%)
Ig strand D 117..121 CDD:409353 0/3 (0%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 3/7 (43%)
zgc:153911NP_001070783.1 V-set 28..122 CDD:284989 18/99 (18%)
IG_like 35..133 CDD:214653 19/106 (18%)
Ig <156..221 CDD:299845 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.