Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070783.1 | Gene: | zgc:153911 / 768172 | ZFINID: | ZDB-GENE-061013-174 | Length: | 288 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 30/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 LLLSAHCLKDLKIFVPEAVLM---GNAATLSCQYDLEQA---ALYAVRW----------YFGQEE 93
Fly 94 FYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHM 158
Fly 159 QVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDTYEGS 223
Fly 224 TTYSS 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 17/88 (19%) |
Ig strand B | 67..76 | CDD:409353 | 2/8 (25%) | ||
CDR1 | 76..83 | CDD:409353 | 0/9 (0%) | ||
Ig strand C | 83..91 | CDD:409353 | 2/17 (12%) | ||
FR2 | 84..91 | CDD:409353 | 2/16 (13%) | ||
CDR2 | 94..108 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 94..99 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 102..104 | CDD:409353 | 0/1 (0%) | ||
FR3 | 109..143 | CDD:409353 | 8/33 (24%) | ||
Ig strand D | 117..121 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 123..127 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 136..144 | CDD:409353 | 3/7 (43%) | ||
zgc:153911 | NP_001070783.1 | V-set | 28..122 | CDD:284989 | 18/99 (18%) |
IG_like | 35..133 | CDD:214653 | 19/106 (18%) | ||
Ig | <156..221 | CDD:299845 | 10/40 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |