| Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001369656.1 | Gene: | F11R / 50848 | HGNCID: | 14685 | Length: | 327 | Species: | Homo sapiens |
| Alignment Length: | 229 | Identity: | 52/229 - (22%) |
|---|---|---|---|
| Similarity: | 90/229 - (39%) | Gaps: | 28/229 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 IIISELLLSAHCL--KDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPREA 102
Fly 103 KPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPKDD 167
Fly 168 PVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTP--LQRISQDTYEGSTTYSSLD 230
Fly 231 IYPNS---------QALQGFFETKYQHSVNLQCV 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 24/75 (32%) |
| Ig strand B | 67..76 | CDD:409353 | 4/8 (50%) | ||
| CDR1 | 76..83 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 83..91 | CDD:409353 | 3/7 (43%) | ||
| FR2 | 84..91 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 94..108 | CDD:409353 | 4/13 (31%) | ||
| Ig strand C' | 94..99 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 102..104 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 109..143 | CDD:409353 | 11/33 (33%) | ||
| Ig strand D | 117..121 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 123..127 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 136..144 | CDD:409353 | 4/7 (57%) | ||
| F11R | NP_001369656.1 | IgV_1_JAM1-like | 30..129 | CDD:409538 | 30/112 (27%) |
| Ig strand B | 46..50 | CDD:409538 | 1/3 (33%) | ||
| Ig strand C | 59..63 | CDD:409538 | 1/3 (33%) | ||
| Ig strand E | 92..96 | CDD:409538 | 1/3 (33%) | ||
| Ig strand F | 106..111 | CDD:409538 | 2/4 (50%) | ||
| Ig strand G | 121..124 | CDD:409538 | 1/2 (50%) | ||
| IgI_2_JAM1 | 135..231 | CDD:409542 | 17/96 (18%) | ||
| Ig strand B | 149..153 | CDD:409542 | 0/3 (0%) | ||
| Ig strand C | 163..167 | CDD:409542 | 1/3 (33%) | ||
| Ig strand E | 195..199 | CDD:409542 | 1/3 (33%) | ||
| Ig strand F | 209..214 | CDD:409542 | 0/4 (0%) | ||
| Ig strand G | 224..227 | CDD:409542 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||