DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and CEACAM6

DIOPT Version :10

Sequence 1:NP_651619.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_002474.4 Gene:CEACAM6 / 4680 HGNCID:1818 Length:344 Species:Homo sapiens


Alignment Length:140 Identity:36/140 - (25%)
Similarity:61/140 - (43%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PREAKPTFVFAVAGIN------VDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAH 157
            |.....|:::.|.|.:      :.|:|.:.| :||..|.|..:|||:||:...|....::  ...
Human   169 PEVQNTTYLWWVNGQSLPVSPRLQLSNGNMT-LTLLSVKRNDAGSYECEIQNPASANRSD--PVT 230

  Fly   158 MQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDTYEG 222
            :.|:..| |.|.:...|......:|....|... |.|||..:|.|||.      .|:.:|:.:..
Human   231 LNVLYGP-DVPTISPSKANYRPGENLNLSCHAA-SNPPAQYSWFINGT------FQQSTQELFIP 287

  Fly   223 STTYSSLDIY 232
            :.|.::...|
Human   288 NITVNNSGSY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_651619.1 Ig 67..144 CDD:472250 16/50 (32%)
Ig strand B 69..73 CDD:409353
Ig strand C 84..88 CDD:409353
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 137..142 CDD:409353 3/4 (75%)
CEACAM6NP_002474.4 IgV_CEACAM_D1 36..140 CDD:409430
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430
Ig strand C' 78..83 CDD:409430
Ig strand C' 88..91 CDD:409430
FR3 98..124 CDD:409430
Ig strand D 98..103 CDD:409430
Ig strand E 105..109 CDD:409430
Ig strand F 119..124 CDD:409430
CDR3 125..132 CDD:409430
FR4 133..140 CDD:409430
Ig strand G 133..139 CDD:409430
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 17/67 (25%)
Ig strand A 146..150 CDD:409402
Ig strand A' 153..158 CDD:409402
Ig strand B 163..169 CDD:409402 36/140 (26%)
Ig strand C 176..181 CDD:409402 0/4 (0%)
Ig strand C' 183..186 CDD:409402 0/2 (0%)
Ig strand D 190..194 CDD:409402 0/3 (0%)
Ig strand E 197..202 CDD:409402 1/5 (20%)
Ig strand F 212..220 CDD:409402 4/7 (57%)
Ig strand G 224..233 CDD:409402 0/10 (0%)
IgC2_CEACAM5-like 243..318 CDD:409540 15/62 (24%)
Ig strand A 243..249 CDD:409540 1/5 (20%)
Ig strand B 254..261 CDD:409540 2/6 (33%)
Ig strand C 267..273 CDD:409540 2/5 (40%)
Ig strand C' 276..281 CDD:409540 1/10 (10%)
Ig strand E 284..290 CDD:409540 0/5 (0%)
Ig strand F 293..304 CDD:409540 1/5 (20%)
Ig strand G 307..318 CDD:409540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.