| Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262876.1 | Gene: | beat-IV / 42778 | FlyBaseID: | FBgn0039089 | Length: | 446 | Species: | Drosophila melanogaster |
| Alignment Length: | 203 | Identity: | 61/203 - (30%) |
|---|---|---|---|
| Similarity: | 102/203 - (50%) | Gaps: | 15/203 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 EQAALYAVRWYFGQEEFYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEV 142
Fly 143 SEDAPLFHTEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQI 207
Fly 208 -RRTPLQRISQDTYEGSTTYSSLDIYPNSQALQGFFETKYQH--SVNLQCVVTIRHMYHK----- 264
Fly 265 VVAQRIGL 272 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 29/63 (46%) |
| Ig strand B | 67..76 | CDD:409353 | |||
| CDR1 | 76..83 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C | 83..91 | CDD:409353 | 4/7 (57%) | ||
| FR2 | 84..91 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 94..108 | CDD:409353 | 7/13 (54%) | ||
| Ig strand C' | 94..99 | CDD:409353 | 4/4 (100%) | ||
| Ig strand C' | 102..104 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 109..143 | CDD:409353 | 14/33 (42%) | ||
| Ig strand D | 117..121 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 123..127 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 136..144 | CDD:409353 | 5/7 (71%) | ||
| beat-IV | NP_001262876.1 | Ig | <212..285 | CDD:299845 | 32/72 (44%) |
| Ig | 314..>362 | CDD:299845 | 11/54 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000798 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21261 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||