| Sequence 1: | NP_001263035.1 | Gene: | beat-VI / 43377 | FlyBaseID: | FBgn0039584 | Length: | 332 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611841.1 | Gene: | CG5597 / 37789 | FlyBaseID: | FBgn0034920 | Length: | 260 | Species: | Drosophila melanogaster |
| Alignment Length: | 200 | Identity: | 48/200 - (24%) |
|---|---|---|---|
| Similarity: | 85/200 - (42%) | Gaps: | 39/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 71 LSCQYDLEQAALY-AVRWYFGQEEFYRYV---PREAKPTFVFAVAGINVDLANSDAT-------S 124
Fly 125 VTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTV 189
Fly 190 GPSYPPANITWSING-NQIRRTPLQRISQDTY-EGSTTYSSLDIYPNSQALQGFFETKYQHSVNL 252
Fly 253 QCVVT 257 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-VI | NP_001263035.1 | Ig | 66..142 | CDD:416386 | 20/81 (25%) |
| Ig strand B | 67..76 | CDD:409353 | 2/4 (50%) | ||
| CDR1 | 76..83 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 83..91 | CDD:409353 | 3/8 (38%) | ||
| FR2 | 84..91 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 94..108 | CDD:409353 | 5/16 (31%) | ||
| Ig strand C' | 94..99 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C' | 102..104 | CDD:409353 | 1/1 (100%) | ||
| FR3 | 109..143 | CDD:409353 | 8/40 (20%) | ||
| Ig strand D | 117..121 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 123..127 | CDD:409353 | 2/10 (20%) | ||
| Ig strand F | 136..144 | CDD:409353 | 4/7 (57%) | ||
| CG5597 | NP_611841.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21261 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||