DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and beat-IIIa

DIOPT Version :9

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster


Alignment Length:273 Identity:85/273 - (31%)
Similarity:135/273 - (49%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RIRSRPEEGRKGRRMSSACRPGALHTAFNMLALSWIIISELLL-----SAHCLKDLKIFVPEAVL 64
            |:....::|..|.|.|:..|     ||...|.: |.|:..:|:     |:..:.::||  |..::
  Fly    28 RMNMEQQDGTPGARKSATAR-----TAATSLQI-WYILHVILVLIDISSSLTMTEVKI--PNHIM 84

  Fly    65 MGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKG 129
            ...:|||.|:|.|:..:||:|:||....|.||||||:..|...|.:.|:|:||.||..|.:.|:.
  Fly    85 RLKSATLGCRYALDGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPLPGVNIDLRNSSDTQILLRR 149

  Fly   130 VTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYP 194
            ||.:.||.|:||||.:||.|:|...|..|.|:..|...|.:...:....:.|..:..||..||.|
  Fly   150 VTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKP 214

  Fly   195 PANITWSINGNQIRRTPLQR-----ISQDTYEGSTTYSSLDIYPNSQALQGF-FETKYQH----S 249
            ..:::|.|||..:::|.|::     :::|..|              .|..|. |..:..|    .
  Fly   215 VCHLSWLINGEPVQKTHLRQYDKVVVNRDGLE--------------MARLGLEFRVRSFHFKHGD 265

  Fly   250 VNLQCVVTIRHMY 262
            :.|:||..|..:|
  Fly   266 MKLKCVAKISSLY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 Ig 66..142 CDD:416386 34/75 (45%)
Ig strand B 67..76 CDD:409353 4/8 (50%)
CDR1 76..83 CDD:409353 1/6 (17%)
Ig strand C 83..91 CDD:409353 4/7 (57%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 7/13 (54%)
Ig strand C' 94..99 CDD:409353 3/4 (75%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 15/33 (45%)
Ig strand D 117..121 CDD:409353 2/3 (67%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 5/7 (71%)
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 44/95 (46%)
IG_like 88..182 CDD:214653 44/93 (47%)
Ig 188..>227 CDD:299845 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.