DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and beat-IIIb

DIOPT Version :9

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:118/253 - (46%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CRPGALHTAFNMLALSWIIISELLL-SAHCLKDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVR 86
            ||....:.|.      :|::.:|.. |..||...:|.:|:.::....|.|.|::||:..:||:|:
  Fly     7 CRYSLAYGAL------FILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVK 65

  Fly    87 WYFGQEEFYRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHT 151
            ||....||||||||:..|..||.:.|::|:|.||....|.|:.|:.:.:|.|:||||.:||.|.|
  Fly    66 WYKDGFEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQT 130

  Fly   152 EIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRIS 216
            ......|.|:..||..|.:...:....:.|..:..||...|.|..:::|.|||....|:.|:   
  Fly   131 VSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLR--- 192

  Fly   217 QDTYEGSTTYSSLDIYPNSQALQGF--------FETKYQH----SVNLQCVVTIRHMY 262
              .||           |.....:|.        |..:..|    .:.|:||..|..:|
  Fly   193 --PYE-----------PLIVGREGLEVARLGLEFRVRGXHFKHGDMKLKCVAKISSVY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 Ig 66..142 CDD:416386 32/75 (43%)
Ig strand B 67..76 CDD:409353 3/8 (38%)
CDR1 76..83 CDD:409353 2/6 (33%)
Ig strand C 83..91 CDD:409353 4/7 (57%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 8/13 (62%)
Ig strand C' 94..99 CDD:409353 4/4 (100%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 12/33 (36%)
Ig strand D 117..121 CDD:409353 2/3 (67%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 5/7 (71%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.