DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and beat-Ib

DIOPT Version :9

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:241 Identity:76/241 - (31%)
Similarity:113/241 - (46%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LKDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPREAKPTFVFAVAG-INV 115
            |:::.:.:|.||..|:.|.|.|.||:|...||.|:||.|:.|||||.|:|.....:|.... |:|
  Fly    29 LRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDV 93

  Fly   116 DLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPKDDPVMQVDKKVIGVN 180
            :.|.|:|:.|.|:.|...:||.:.||||.|||.|.|.|.:|.|:|:|||...|:      :.|::
  Fly    94 ETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPI------ITGIH 152

  Fly   181 DNFK------AVCTVGPSYPPANITWSING-----NQIRRTPLQRISQDTYEGSTTYSSLDIYPN 234
            ..::      ..|:...|.|.||:||.||.     |.:|...:||...:..|.:.          
  Fly   153 SRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVAEHLESAV---------- 207

  Fly   235 SQALQGFFETKYQHSVNLQCVVTIRHM------------YHKVVAQ 268
                   .|.|:        |||:.|.            .|::.||
  Fly   208 -------LEIKF--------VVTVHHFIKSRLKLKCSARIHEIYAQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 Ig 66..142 CDD:416386 32/76 (42%)
Ig strand B 67..76 CDD:409353 3/8 (38%)
CDR1 76..83 CDD:409353 2/6 (33%)
Ig strand C 83..91 CDD:409353 4/7 (57%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 6/13 (46%)
Ig strand C' 94..99 CDD:409353 4/4 (100%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 12/34 (35%)
Ig strand D 117..121 CDD:409353 1/3 (33%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 4/7 (57%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.