DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and ceacam1

DIOPT Version :10

Sequence 1:NP_651619.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001107266.1 Gene:ceacam1 / 114465 ZFINID:ZDB-GENE-010724-14 Length:1025 Species:Danio rerio


Alignment Length:344 Identity:77/344 - (22%)
Similarity:110/344 - (31%) Gaps:115/344 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CRPGALHT----AFNMLALSWIIISELLLSAHCLKDLKIFVPEAVLMGNAATLSCQYDLEQAALY 83
            |.||....    :.|.:|:...:..::..|......|.:|.|..:.|                  
Zfish    13 CAPGLCQVNVVPSNNPVAVGSNVTLDVNSSMPITVGLWLFGPSTLFM------------------ 59

  Fly    84 AVRWYFGQEEFYRYVP-REAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAP 147
               ||.|.     .:| ...:|...|          ||....:||..||.|.||.|..:|.:.  
Zfish    60 ---WYMGD-----IIPGNSLQPGVYF----------NSSTYQLTLSAVTLESSGVYVLDVYKP-- 104

  Fly   148 LFHTEIRSAHMQVIELPKDDPVMQVDKKV-----IGVNDNFKAVCTVGPSYPPANITWSINGNQI 207
               ..|||.    |.|...:||..|:..|     :.|||.....|:|..|  |...:| :|||..
Zfish   105 ---NRIRSE----ITLEVQEPVGNVNTTVNTTNLVEVNDTVYFTCSVTTS--PVWFSW-LNGNSA 159

  Fly   208 ----RRTPLQRISQD-TYEGSTTYSSLDIYPNSQALQGFFE------TKYQHSVNLQCVV----- 256
                .|..||...|. ...|.|.|.           :|.|:      ...|.||.::..:     
Zfish   160 VKDGGRVQLQNSGQTLIINGVTRYD-----------EGPFKCVVVNNISSQQSVEMKLNISYGPG 213

  Fly   257 --TIRHMYHKVV-------AQRIGLNAAPPTT----ISPNLLGLEG-----SKRYANGDPDNSAL 303
              |:..|..|.|       :.....::.|..|    ::.|||.:.|     :|...|        
Zfish   214 NLTLTAMPEKTVYISGSNFSLSCSADSKPTATFNWMLNGNLLNVNGPVYVFTKATQN-------- 270

  Fly   304 TGASQRCCICCGAFGAVSL 322
                |.....|||..|.:|
Zfish   271 ----QSGVYTCGAQNAATL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_651619.1 Ig 67..144 CDD:472250 17/77 (22%)
Ig strand B 69..73 CDD:409353 0/3 (0%)
Ig strand C 84..88 CDD:409353 0/3 (0%)
Ig strand E 123..127 CDD:409353 0/3 (0%)
Ig strand F 137..142 CDD:409353 1/4 (25%)
ceacam1NP_001107266.1 Ig 30..116 CDD:472250 28/130 (22%)
Ig strand B 35..39 CDD:409353 0/3 (0%)
Ig strand C 47..51 CDD:409353 1/3 (33%)
Ig strand E 82..86 CDD:409353 0/3 (0%)
Ig strand F 96..101 CDD:409353 1/4 (25%)
Ig strand G 108..111 CDD:409353 2/6 (33%)
Ig 134..208 CDD:472250 23/87 (26%)
Ig strand B 138..142 CDD:409353 0/3 (0%)
Ig strand C 151..155 CDD:409353 1/4 (25%)
Ig strand E 173..177 CDD:409353 1/3 (33%)
Ig strand F 187..192 CDD:409353 1/4 (25%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 221..281 CDD:472250 14/71 (20%)
Ig strand B 232..236 CDD:409353 0/3 (0%)
Ig strand C 245..249 CDD:409353 1/3 (33%)
Ig strand E 260..264 CDD:409353 0/3 (0%)
Ig strand F 274..279 CDD:409353 1/4 (25%)
Ig 307..387 CDD:472250
Ig strand B 317..321 CDD:409353
Ig strand C 330..334 CDD:409353
Ig strand E 352..356 CDD:409353
Ig strand F 366..371 CDD:409353
Ig 403..469 CDD:472250
Ig strand B 407..411 CDD:409353
Ig strand C 420..424 CDD:409353
Ig strand E 437..441 CDD:409353
Ig strand F 448..453 CDD:409353
Ig strand G 463..466 CDD:409353
Ig 492..564 CDD:472250
Ig strand B 493..497 CDD:409353
Ig strand C 506..510 CDD:409353
Ig strand E 528..532 CDD:409353
Ig strand F 542..547 CDD:409353
Ig strand G 557..560 CDD:409353
Ig_3 577..632 CDD:464046
Ig 654..741 CDD:472250
Ig strand B 670..674 CDD:409353
Ig strand C 683..687 CDD:409353
Ig strand E 705..709 CDD:409353
Ig strand F 719..724 CDD:409353
Ig strand G 734..737 CDD:409353
Ig_3 752..809 CDD:464046
Ig 846..918 CDD:472250
Ig strand B 847..851 CDD:409353
Ig strand C 860..864 CDD:409353
Ig strand E 882..886 CDD:409353
Ig strand F 896..901 CDD:409353
Ig strand G 911..914 CDD:409353
Ig_3 925..982 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.