DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and sirpb1

DIOPT Version :10

Sequence 1:NP_651619.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_031748713.1 Gene:sirpb1 / 100496188 XenbaseID:XB-GENE-29083055 Length:852 Species:Xenopus tropicalis


Alignment Length:303 Identity:68/303 - (22%)
Similarity:118/303 - (38%) Gaps:84/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LSWIIISELLLSAHCLKDLKIFVP--EAVLMGNAATLSCQYDLEQAAL----YAVRWYFGQEEFY 95
            |.:::...||...|| ..|::.||  ::..||..|.|.|.:.::...:    .|:.|:||.:|..
 Frog    10 LGFLLSLLLLQHRHC-SALEVTVPPDQSSPMGRDALLPCTFRVDNPPMNPKFLAILWHFGDKEVL 73

  Fly    96 RY-------VPREAKPTFVFAVAGINVD---LANSDATSVTLKGVTRELSGSYQCEVSEDAPLFH 150
            ||       .||            :::|   |...:| |::|..||....|:|:|.|........
 Frog    74 RYDNKGKVSSPR------------VSIDERALLEGNA-SLSLSNVTVSDGGTYRCSVIYSPETQK 125

  Fly   151 TEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPP-ANITWSINGNQIRRT---P 211
            .|||   :::..||:    :.|.|:.:..|......|:|...||. ..:||..||..:..:   |
 Frog   126 KEIR---LRIHALPE----VVVAKRTLVRNQGTALRCSVTDFYPQRITVTWLRNGKVLPNSALGP 183

  Fly   212 LQRISQDTYEGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQCVV-----------TIRHMYHKV 265
            ||:.:..|:..::|   |.:.|:..          :.:..:.|:|           :.|..|   
 Frog   184 LQQNADGTFRLNST---LTLTPSDT----------EDTPEIACLVQHESLPTPRRDSFRVQY--- 232

  Fly   266 VAQRIGLNAAPPTTISPNLLGLEGSKRYANGDPDNSALTGASQ 308
                    ..||:        ::......||.|:...:..|||
 Frog   233 --------GVPPS--------VQVYSAKINGRPEQVLVCEASQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_651619.1 Ig 67..144 CDD:472250 23/90 (26%)
Ig strand B 69..73 CDD:409353 2/3 (67%)
Ig strand C 84..88 CDD:409353 1/3 (33%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 137..142 CDD:409353 2/4 (50%)
sirpb1XP_031748713.1 V-set 30..133 CDD:462230 30/118 (25%)
C1-set 153..220 CDD:462221 17/79 (22%)
Ig 234..315 CDD:472250 8/34 (24%)
Ig strand B 251..255 CDD:409353 0/3 (0%)
Ig strand C 266..270 CDD:409353
Ig strand E 291..295 CDD:409353
Ig strand F 302..310 CDD:409353
IgC1 <617..702 CDD:409354
Ig strand C 626..632 CDD:409354
Ig strand C' 639..640 CDD:409354
Ig strand D 648..658 CDD:409354
Ig strand E 665..673 CDD:409354
Ig strand F 684..691 CDD:409354
Ig strand G 699..702 CDD:409354
Ig 701..804 CDD:472250
Ig strand B 712..716 CDD:409353
Ig strand C 736..740 CDD:409353
Ig strand E 771..782 CDD:409353
Ig strand F 789..793 CDD:409353
Ig strand G 801..804 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.