DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and LOC100493192

DIOPT Version :10

Sequence 1:NP_651619.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_031748759.1 Gene:LOC100493192 / 100493192 XenbaseID:XB-GENE-29081579 Length:908 Species:Xenopus tropicalis


Alignment Length:235 Identity:63/235 - (26%)
Similarity:96/235 - (40%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WIIISELLL-SAHCLKDLKIFVPEAVLMGNAATLSCQYDLEQAAL----YAVRWYFGQEEFYRY- 97
            |..:..|:| :|..:.|:....|:.||:||.|.|.|.:.|.:..:    .||.|||...|..|| 
 Frog     4 WGFLLFLVLPAAGSILDISAPSPKRVLLGNEAQLRCTFSLAKPPINPLFLAVFWYFQDMEILRYD 68

  Fly    98 ------VPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSA 156
                  .||.|          .:.:.||:...||:|..|:....|.|:|.|.........|:   
 Frog    69 NKGLSLSPRVA----------FSKEAANNGDVSVSLANVSISDGGIYRCLVIYSPEKMEKEV--- 120

  Fly   157 HMQVIEL--PKDDPVMQVDKKVIGVNDNFKAVCTVGPSYP-PANITWSINGNQIRRTPL---QRI 215
               ::|:  |   ||:::..|||..|......||....|| ...|.|..:..::..:.|   :|.
 Frog   121 ---LLEIFAP---PVIRIPNKVIQKNKENTLTCTASGFYPVDIRIIWFRDNEELTNSELDKPERN 179

  Fly   216 SQDTY--EGSTTYSSLDIYPNSQALQGFFETKYQHSVNLQ 253
            ...||  .|:.|...:|     ..|...|..:.|| ::||
 Frog   180 PDGTYRVRGTVTLPPMD-----GQLDHNFSCRVQH-LSLQ 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_651619.1 Ig 67..144 CDD:472250 26/87 (30%)
Ig strand B 69..73 CDD:409353 2/3 (67%)
Ig strand C 84..88 CDD:409353 2/3 (67%)
Ig strand E 123..127 CDD:409353 2/3 (67%)
Ig strand F 137..142 CDD:409353 2/4 (50%)
LOC100493192XP_031748759.1 V-set 24..124 CDD:462230 31/115 (27%)
IgC1 139..217 CDD:409354 20/81 (25%)
Ig strand B 143..150 CDD:409354 2/6 (33%)
Ig strand C 156..162 CDD:409354 1/5 (20%)