DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-VI and esam

DIOPT Version :9

Sequence 1:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001135525.1 Gene:esam / 100216067 XenbaseID:XB-GENE-963268 Length:438 Species:Xenopus tropicalis


Alignment Length:219 Identity:47/219 - (21%)
Similarity:76/219 - (34%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHTAFNMLALSWIIISELLLSAHCLKDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQE 92
            |.||..::.::|     .||..|..|...|.|.     |....|...|.........:.|:    
 Frog    14 LGTAHLLINVTW-----ALLEVHVEKTTIIAVE-----GKTVVLPVWYSSSSHQNPYITWH---- 64

  Fly    93 EFYRYVPREAKPTFVFAVAGIN-------VDLAN---SDATSVTLKGVTREL-SGSYQC--EVSE 144
             |.|...:|.:......|..::       |..|.   |...|:.:.. |:|: ||.|:|  .|::
 Frog    65 -FVRAPSKEIQIIKYLQVTSVDDTQFKNRVKFAEPMPSKNISIIINN-TQEIDSGIYKCLVNVAD 127

  Fly   145 DAPLFHTEIRSAHMQVIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRR 209
            |..:........::.|| :|...|..|:..... ...|....|......|....:|      ||.
 Frog   128 DTSVGGGNSGEINVTVI-VPPSIPKCQIQGTPY-TGSNVTLTCKSSAGKPEPGYSW------IRS 184

  Fly   210 TPLQRI----SQDTYEGSTTYSSL 229
            .|..:|    :||..:|:.:..:|
 Frog   185 APTTQIFFAPTQDVAKGTLSLINL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VINP_001263035.1 Ig 66..142 CDD:416386 18/88 (20%)
Ig strand B 67..76 CDD:409353 1/8 (13%)
CDR1 76..83 CDD:409353 0/6 (0%)
Ig strand C 83..91 CDD:409353 1/7 (14%)
FR2 84..91 CDD:409353 1/6 (17%)
CDR2 94..108 CDD:409353 3/13 (23%)
Ig strand C' 94..99 CDD:409353 2/4 (50%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 11/46 (24%)
Ig strand D 117..121 CDD:409353 1/6 (17%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 4/9 (44%)
esamNP_001135525.1 V-set 35..143 CDD:369466 22/118 (19%)
IG_like 161..235 CDD:214653 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.