DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or94b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:269 Identity:54/269 - (20%)
Similarity:107/269 - (39%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 YCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISYFWNVCAALGVALP 194
            |.:|...|...:|..:|  :.:|...||    ||....|::......|..::.:||.|.....|.
  Fly   133 YWYIWGSLFVAVMGYIS--VFFQEDYEL----PFGYYVPFEWRTRERYFYAWGYNVVAMTLCCLS 191

  Fly   195 TVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRP- 258
            .:.:|||.|....::.:||::...::...:....::....|:.:|||:.....|.........| 
  Fly   192 NILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPY 256

  Fly   259 LICQFVAASLHLCVLCYQL-SANILQPALLFYAA--FTAAVVGQVSIYCFCGSSIHSECQLFGQA 320
            ::.|.|.::..:|...|:| .....|...||...  |.|.::.|:.:.|:.|:.:.........:
  Fly   257 VLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNS 321

  Fly   321 IYESSWPHLLQENLQLVSSLKIAM-MRSSLGCPID----------GYFFEANRETLITIVRTAIS 374
            ::.::|             |:.:: .|..|.|.::          |.|||......:..:..|.|
  Fly   322 VFGTNW-------------LEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYS 373

  Fly   375 YVTLLRSLA 383
            :..||..::
  Fly   374 FFALLLKIS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 50/256 (20%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 50/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.