DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or94a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:429 Identity:86/429 - (20%)
Similarity:164/429 - (38%) Gaps:105/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRLQSALFRLLGLELLHEQDVGHRYPW---------------RSICCILSVASFMPLTIAF-GLQ 55
            :||...:.:|.||           :||               |:...:|    .:|:|..| ||.
  Fly    11 MRLILQVMQLFGL-----------WPWSLKSEEEWTFTGFVKRNYRFLL----HLPITFTFIGLM 60

  Fly    56 NVQ-----NVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVT 115
            .::     |:||....|...:.::..:.|| |.:|.|:...:.       |..|...|....:..
  Fly    61 WLEAFISSNLEQAGQVLYMSITEMALVVKI-LSIWHYRTEAWR-------LMYELQHAPDYQLHN 117

  Fly   116 RES----RRDQ--FISAMYAYCFITAGL--SACLMSPLSMLISYQRTGELQPKFPFPSVYP--WD 170
            :|.    ||:|  |....|.|..|:.|:  |.|  :.:..|..|:        .||....|  |.
  Fly   118 QEEVDFWRREQRFFKWFFYIYILISLGVVYSGC--TGVLFLEGYE--------LPFAYYVPFEWQ 172

  Fly   171 NMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKET---H 232
            |.:  .|..:|.:::.......:..:.:|||.|....::..|:::...::.  |.:|.|..   .
  Fly   173 NER--RYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRLR--ETKNMKNDTIFG 233

  Fly   233 ENLKHVF----QLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLS-----------ANIL 282
            :.|:.:|    ::.:|.|.....::.|   ::.|.:.::|.:|...|:|.           .::|
  Fly   234 QQLRAIFIMHQRIRSLTLTCQRIVSPY---ILSQIILSALIICFSGYRLQHVGIRDNPGQFISML 295

  Fly   283 QPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRS 347
            |        |.:.::.|:.:.|:.|:.|..........:|.::|    .|....:..|..|.| .
  Fly   296 Q--------FVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNW----LECRPPIRKLLNAYM-E 347

  Fly   348 SLGCPID---GYFFEANRETLITIVRTAISYVTLLRSLA 383
            .|..|:.   |.||.......:..:..|.|::.||.:::
  Fly   348 HLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLNVS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 68/343 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 68/344 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.