DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or92a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:411 Identity:92/411 - (22%)
Similarity:172/411 - (41%) Gaps:57/411 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DKFLRLQSALFRLLGLELLHEQD--VGHRYPWR--SICCILSVASFMPLTIAFGLQNVQNVEQLT 64
            |:..|.....::.:|.:|..::|  |..||..|  .:...|:..:::...||:.:.::.:...|.
  Fly    18 DELTRFPMTFYKTIGEDLYSDRDPNVIRRYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLL 82

  Fly    65 DSLCSVLVDLLALCKIGL-FLWLYKDFKFLIGQFYCV-----------LQTETHTAVAEMIVTRE 117
            ::..      :|.| ||. |:..:|.|...:.:...|           |..|...........:.
  Fly    83 EATA------VAPC-IGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKH 140

  Fly   118 SRRDQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGE--LQPKFPFPSVYPWD-NMKLSNYII 179
            ..|   :..::....:|...|......:...|.|...|.  .:..:.|..::|:| ...|:.|..
  Fly   141 MNR---VMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEIFERNYGFHILFPYDAETDLTVYWF 202

  Fly   180 SYFWNV--CA-ALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQL 241
            || |.:  || ..||:.  ||||.|..:....|...|....:.:..:||.:..: .||:|::..|
  Fly   203 SY-WGLAHCAYVAGVSY--VCVDLLLIATITQLTMHFNFIANDLEAYEGGDHTD-EENIKYLHNL 263

  Fly   242 ---YALCLNLGHFLNEYFRPLIC-QFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSI 302
               :|..|:|...:|..|..||. .|:||||.:|...:|::|:.::..:|::..|:|::| ||.:
  Fly   264 VVYHARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQITASNVEDIVLYFIFFSASLV-QVFV 327

  Fly   303 YCFCGSSIHSECQLFGQAIYESSW-------PHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEA 360
            .|:.|..:.|.....|.:.:..:|       ..:||  ..:..|.|.|.:|.....||       
  Fly   328 VCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQ--FIIARSQKPASIRPPTFPPI------- 383

  Fly   361 NRETLITIVRTAISYVTLLRS 381
            :..|.:.::..:..:..|||:
  Fly   384 SFNTFMKVISMSYQFFALLRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 77/341 (23%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 77/339 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.