DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or88a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:78/232 - (33%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 YIISYFWN-VCAALGVALPTVCVDTLFCSL-SHNLCALFQIARHKMMHFEGRNTKETHENLKHVF 239
            |::.:.:: :|...||:. .|..|.||..: .|.:..|..:||    .|...:.:::..:.|..|
  Fly   193 YLLVWSFDLMCTTCGVSF-FVTFDNLFNVMQGHLVMHLGHLAR----QFSAIDPRQSLTDEKRFF 252

  Fly   240 -------QLYALCLNLGHFLNEYFRP--LICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAA 295
                   |...|...|....|:.|:.  |:..||.|. .||...:.||.......:..|...|..
  Fly   253 VDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAG-SLCFYLFMLSETSDVLIIAQYILPTLV 316

  Fly   296 VVGQVSIYCFCGSSIHS-----ECQLFGQAIYESS---------WPHLLQENLQLVSSLKIAMMR 346
            :||.....|..|:.:..     |..|..|..|..|         |....|...||          
  Fly   317 LVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQL---------- 371

  Fly   347 SSLGCPIDGYF--FEANRETLITIVRTAISYVTLLRS 381
                    |.|  .:.|......|::.|....|.|:|
  Fly   372 --------GAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 47/221 (21%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 47/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.