DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or85c

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:326 Identity:63/326 - (19%)
Similarity:124/326 - (38%) Gaps:33/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMI-VTRESRRDQFISAMYAYCFITAGL 137
            ::.:.|:....|...|...|:.:...:.  ....|..||. :.|..|....||..||..:.....
  Fly    77 IVGMSKMFFIWWKKTDLSDLVKELEHIY--PNGKAEEEMYRLDRYLRSCSRISITYALLYSVLIW 139

  Fly   138 SACLMSPLSMLISYQRTGELQ---PKFPFPSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVD 199
            :..|.|.:..|: |::..:::   ...|:...:||:..:...|.:..|....|....|...:..|
  Fly   140 TFNLFSIMQFLV-YEKLLKIRVVGQTLPYLMYFPWNWHENWTYYVLLFCQNFAGHTSASGQISTD 203

  Fly   200 TLFCSLSHNLCALFQIARHKMMHFE-----------GRNTKETHENLKHVFQLYALCLNLGHFLN 253
            .|.|:          :|...:|||:           .|:..|....|....|.:...|.|...||
  Fly   204 LLLCA----------VATQVVMHFDYLARVVEKQVLDRDWSENSRFLAKTVQYHQRILRLMDVLN 258

  Fly   254 EYFR-PLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLF 317
            :.|. ||:..|:.::..:|.:.:|::..:....::....|..:.:.||.:.|..|..|.......
  Fly   259 DIFGIPLLLNFMVSTFVICFVGFQMTVGVPPDIMIKLFLFLFSSLSQVYLICHYGQLIADASSSL 323

  Fly   318 GQAIYESSWPHL-LQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLLRS 381
            ..:.|:.:|.:. ::....||..:......:.|...|   |....|.|:..:::.:..:..|||:
  Fly   324 SISAYKQNWQNADIRYRRALVFFIARPQRTTYLKATI---FMNITRATMTDLLQVSYKFFALLRT 385

  Fly   382 L 382
            :
  Fly   386 M 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 60/314 (19%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 60/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.