DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or85b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:412 Identity:87/412 - (21%)
Similarity:157/412 - (38%) Gaps:96/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLV-------DLLALCKIGLF--LWLYKDF---K 91
            ::..|||  ...|.|::...|.|   :|..:.|:       :::.|..:|||  :::|..|   |
  Fly     4 LMKYASF--FYTAVGIRPYTNGE---ESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNK 63

  Fly    92 FL-------------IGQFYCVLQTETHTAVAEMI----------VTRE------------SRRD 121
            ||             :|...........||:.|:|          :.||            ||..
  Fly    64 FLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRIS 128

  Fly   122 QFISAMYAYCFITAGLSACLMS--PLSMLISYQRTGELQPKFPFPSVYPW---DNMKLSNYIISY 181
            ...|.:|:....|..| .|:|.  .....::.:..|:   :.|:....||   ||.  |.|.:.:
  Fly   129 LIYSLLYSVLIWTFNL-FCVMEYWVYDKWLNIRVVGK---QLPYLMYIPWKWQDNW--SYYPLLF 187

  Fly   182 FWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEG-RNTKETHE----------NL 235
            ..|. |....|...:..|.|.|:          :|...:|||:. .|:.|.||          .|
  Fly   188 SQNF-AGYTSAAGQISTDVLLCA----------VATQLVMHFDFLSNSMERHELSGDWKKDSRFL 241

  Fly   236 KHVFQLYALCLNLGHFLNEYFR-PLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQ 299
            ..:.:.:...|.|...:|:.|. ||:..|:.:|..:|.:.:|::..:....::....|..:.:.|
  Fly   242 VDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQ 306

  Fly   300 VSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSS----LGCPIDGYFFEA 360
            |.:.|..|..:......|..|.|...|   .:.:::...:|.|.:.||.    |...|   |.:.
  Fly   307 VYLICHYGQLVADASYGFSVATYNQKW---YKADVRYKRALVIIIARSQKVTFLKATI---FLDI 365

  Fly   361 NRETLITIVRTAISYVTLLRSL 382
            .|.|:..:::.:..:..|||::
  Fly   366 TRSTMTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 79/380 (21%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 68/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.