DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or74a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:384 Identity:78/384 - (20%)
Similarity:155/384 - (40%) Gaps:105/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LQNVQNVEQLTDSLCS--VLVDLLALCKIGLFLWLYKD-FKFLIGQFYCVL----QTETHTAVA- 110
            :.|.|:::.:...|.:  :||::...|   ..|..:|| |:.|:.:||..:    :.|.|...: 
  Fly    70 IANRQDMDNMLTGLPTYLILVEMQIRC---FQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASI 131

  Fly   111 --EMIVTRESRRDQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMK 173
              :|:.||.:      |.:|....:.     ..:.|::.:|.::|      :..:..|||:||.:
  Fly   132 QRQMLATRVN------STVYLLALLN-----FFLVPVTNVIYHRR------EMLYKQVYPFDNTQ 179

  Fly   174 LSNYI---ISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFE------GRNTK 229
            |..:|   :..||     :|..:.::    ||..|:        :....|||..      |::.:
  Fly   180 LHFFIPLLVLNFW-----VGFIITSM----LFGELN--------VMGELMMHLNARYIQLGQDLR 227

  Fly   230 ETHE-----------------NLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQL 277
            .:.:                 ||.|:.:..|...:.|..:.:.|          :|.:.|: :..
  Fly   228 RSAQMLLKKSSSLNVAIAYRLNLTHILRRNAALRDFGQRVEKEF----------TLRIFVM-FAF 281

  Fly   278 SANILQPALLFYAAFT------AAVVGQVSIYC------FCGSSIHSECQLFGQAIYESSWPHLL 330
            ||.:|  ..||:.|||      |.:|..::.:.      ..||.:.......|...|.:.|..::
  Fly   282 SAGLL--CALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTADWEQVI 344

  Fly   331 Q------ENLQLVSSLKIAMMRSSLGCPIDGY-FFEANRETLITIVRTAISYVTLLRSL 382
            .      ||::|:..:.:|:..:|....|.|. :|..:...::.|::.|.||.|.|.|:
  Fly   345 HQSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 70/367 (19%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 70/368 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.