DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or67d

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:65/177 - (36%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVL 273
            ||.|  :..|::.....:.||:.:..:..| ||...|:.|                     ||.:
  Fly   246 LCDL--LVWHQLYTRMLQTTKKIYSIVLFV-QLSTTCVGL---------------------LCTI 286

  Fly   274 -CYQLSANILQPALLFYAAFTAAVVGQVSIYCFC--GSSIHSECQLFGQAIYESS-WPHLLQENL 334
             |..:.|....|..|.|||.|        :|.||  |:.:.:..:.|...||.:. |..|..:..
  Fly   287 SCIFMKAWPAAPLYLLYAAIT--------LYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEE 343

  Fly   335 QLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTA-ISYVTLLR 380
            :|     |.||.:           :|..|.::|....| :|..|.|:
  Fly   344 KL-----IIMMLA-----------KAQNEVVLTAADMAPLSMNTALQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 37/166 (22%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 41/177 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.