DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or67a

DIOPT Version :10

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:94 Identity:19/94 - (20%)
Similarity:26/94 - (27%) Gaps:41/94 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 WDRTFGGGVNNASKLAVASAHDKLCHNFESFNLTYRDTGLWGIYFECDPLMCEDMLFNV-QNEW- 368
            ||..||..:..:.|..:|..         .||.......:|             :|.|| |.|| 
  Fly   257 WDENFGLVMMMSYKGRLACL---------GFNHEKNSRSMW-------------VLENVEQREWS 299

  Fly   369 -----------------MRLCTMVTDGEV 380
                             ..|..:..|||:
  Fly   300 CHTYLPISHYEPGLENYFNLTGITNDGEL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 15/84 (18%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 19/94 (20%)

Return to query results.
Submit another query.