DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or56a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:454 Identity:98/454 - (21%)
Similarity:161/454 - (35%) Gaps:112/454 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTDKFLRLQSALFR--LLGLELLHEQDVGH------RYPWRSI--CCILSVASFMPLTIAFGLQ 55
            |...|.|.|....|.  :.|..|.:.|..|:      ..|..|:  |.||:.:.:  |:.|..|.
  Fly     1 MFKVKDLLLSPTTFEDPIFGTHLRYFQWYGYVASKDQNRPLLSLIRCTILTASIW--LSCALMLA 63

  Fly    56 NV-QNVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTE--------THTAVAE 111
            .| :..|.|.|...|             :....:.|...|..|...:|.:        .|:.:..
  Fly    64 RVFRGYENLNDGATS-------------YATAVQYFAVSIAMFNAYVQRDKVISLLRVAHSDIQN 115

  Fly   112 MIVTRESRRDQFISAMYAYC----------FITAGLSA---C----LMSPLSML-ISYQRTGELQ 158
            ::...::|..:.:.|..||.          .:.|||.|   |    |..|.|:. :...|.||..
  Fly   116 LMHEADNREMELLVATQAYTRTITLLIWIPSVIAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEH 180

  Fly   159 PKFPFPSVYPWDNMKLSNYIISYF--WNVCAALGVALPTVCV-DTLFCSLSHNLCALFQIARHKM 220
            |...| .::|:..: ..|:::.|.  |   .|||:.:..:.: .|....|...:....||...::
  Fly   181 PILLF-QLFPFGEL-CDNFVVGYLGPW---YALGLGITAIPLWHTFITCLMKYVNLKLQILNKRV 240

  Fly   221 MHFE----------GRNT----------------KETHENLKHVFQL-YALCLNLGHFLNEYFRP 258
            ...:          ||.|                ||.....|.|.:| |.:|:           |
  Fly   241 EEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICV-----------P 294

  Fly   259 LICQFVAASLHLCVLCYQLSANILQPALL---FYAAFTAAVVGQVSIYCFCGSSI---HSECQLF 317
            ::..|:..|:.:|.|.:.|:..:  |:.:   |...:...:.|.:.||.:..:.|   |.|..| 
  Fly   295 VMADFIIFSVLICFLFFALTVGV--PSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSL- 356

  Fly   318 GQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLLRS 381
              |.:...|.:.   .:.|...|...||.:.....:.....:.|..|.|.|.|.|.||..||||
  Fly   357 --AYFSCGWYNF---EMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 73/374 (20%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 63/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.