DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or49a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:361 Identity:68/361 - (18%)
Similarity:129/361 - (35%) Gaps:67/361 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DKFLRLQSALFRLLGLELLHEQDVGHRYPW------RSICCILSVASFMPLTIAFGLQNVQNVEQ 62
            :.|:.:.:.:|:.||.:|.|...     ||      |....:.::::|...::.  ...:...|.
  Fly     8 EDFIFMANMMFKTLGYDLFHTPK-----PWWRYLLVRGYFVLCTISNFYEASMV--TTRIIEWES 65

  Fly    63 LTDSLCSVLVDLLALCKIGL--FLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQF-- 123
            |..|...::       :.||  |..|....||:..........:....:.|:...:|..:.::  
  Fly    66 LAGSPSKIM-------RQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEV 123

  Fly   124 ---------ISAMYAYCF--ITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNY 177
                     .:.:|.|.|  :...|...:.|.:..||.:.: .:...|..||:...:|:.|...|
  Fly   124 NKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGK-ADFTYKRIFPTRLTFDSEKPLGY 187

  Fly   178 IISYF-------WNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARH----KMMHFEGRNTKET 231
            :::|.       :.|..:||..|..:||.:             ||:.|    ..|....|.:.||
  Fly   188 VLAYVIDFTYSQFIVNVSLGTDLWMMCVSS-------------QISMHLGYLANMLASIRPSPET 239

  Fly   232 HEN----LKHVFQLYALCLNLGHFLNEYFRPLICQ--FVAASLHLCVLCYQLSANILQPALLFYA 290
            .:.    |..:.:.:.|.:.|...:|..|..|:..  |..:.| ||.:.|...........:.|.
  Fly   240 EQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCL-LCCMAYYTVVEGFNWEGISYM 303

  Fly   291 AFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSW 326
            ...|:|..|..:....|..:........:|.:||.|
  Fly   304 MLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKW 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 58/300 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 51/267 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.