DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or47b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:333 Identity:76/333 - (22%)
Similarity:130/333 - (39%) Gaps:56/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YPWRSI---CCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKF 92
            |.|.::   |.::::  |..:.:|  |...:||.::.|.|..:....|...||........:...
  Fly    61 YRWINLFIMCNVMTI--FWTMFVA--LPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDE 121

  Fly    93 LIGQF-YCVLQTETHTAVAEMIVTRESRRDQFI--SAMYAYCFITAGLSACLMSPLSMLISYQRT 154
            ||..| |...:...|....|::   ..:|..::  |.:|..||       ||::..|..|.    
  Fly   122 LISDFEYYNRELRPHNIDEEVL---GWQRLCYVIESGLYINCF-------CLVNFFSAAIF---- 172

  Fly   155 GELQP-----KFPFPSVYP--WDNMKLSNYI--ISYFWNVCAALGVALPTVCVD----TLFCSLS 206
              |||     |.||.||||  |..:.|..|.  ..|.|....:....:..:.||    :.|...:
  Fly   173 --LQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTA 235

  Fly   207 HNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLI-CQFVAASLHL 270
            .|| .|..|...|:...| .:.|..||....|.:.:...:.|....|..|.... .|.:|:...:
  Fly   236 LNL-KLLCIEIRKLGDME-VSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLI 298

  Fly   271 CVLCYQ-LSANILQP------ALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYE-SSWP 327
            .:..:: ::|..:.|      .||...||.     |:|::|..|:.::::.....||.:: :.| 
  Fly   299 SISTFETMAAAAVDPKMAAKFVLLMLVAFI-----QLSLWCVSGTLVYTQSVEVAQAAFDINDW- 357

  Fly   328 HLLQENLQ 335
            |.....:|
  Fly   358 HTKSPGIQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 70/302 (23%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 70/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.