DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or42b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:339 Identity:71/339 - (20%)
Similarity:118/339 - (34%) Gaps:92/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LWLYKDFKFLIGQ--FYCVLQTETHTAVAEMIVTRESRRDQFISAMYAYCFITAGLSACLMSPLS 146
            ||.....|.::.|  ..|....|...  ..::|.|.:.  .|:...:.||.. || |..|.|.||
  Fly   104 LWRLIKAKNILDQLDLRCTAMEEREK--IHLVVARSNH--AFLIFTFVYCGY-AG-STYLSSVLS 162

  Fly   147 MLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISY------FWNVCAALG--VALPTVCVDTLFC 203
            .          :|        ||   :|.|..|.:      .| |.:.|.  |....|..|.|  
  Fly   163 G----------RP--------PW---QLYNPFIDWHDGTLKLW-VASTLEYMVMSGAVLQDQL-- 203

  Fly   204 SLSHNLCALFQIARHKMMHFEGRNTKETHENLKHV--FQLYALCLNLGHFLNEY---FRPLI--- 260
            |.|:.|.....:..|..|..|......:.|||...  ::....|:.....:..|   .:|:|   
  Fly   204 SDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGT 268

  Fly   261 --CQFVAASLHLCVLCYQLSANILQPALLFYA---------AFTAAVVGQVSIYCFCGSSIHSEC 314
              .||:...|   ||.:.| .|:     .|::         .|...::.|...:|:..:.|..:|
  Fly   269 IFTQFLLIGL---VLGFTL-INV-----FFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDC 324

  Fly   315 QLFGQAIYESSWP-----------HLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITI 368
            :....||::|:|.           :.||...|.:..             |.|..|:.:..:.|::
  Fly   325 ESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVF-------------IAGGIFQISMSSNISV 376

  Fly   369 VRTAISYVTLLRSL 382
            .:.|.|.:|:.:.:
  Fly   377 AKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 68/327 (21%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 68/328 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.