DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or33c

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:332 Identity:74/332 - (22%)
Similarity:122/332 - (36%) Gaps:58/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKD----FKFL 93
            |  ||..|.|.:|        .::.....||...|..:||.|.....:.|.|.|...    ||.|
  Fly    14 W--ICMRLLVPTF--------FKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEFFKNL 68

  Fly    94 IGQFYCV---LQTETHTAVAEMIVTRES---RRDQFISAM--------YAYCFITAGLSACLMSP 144
            .....||   |:...|......||..||   :.|.||::.        :.:|. ....:.||...
  Fly    69 TMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCH-ARRFTRCLYIS 132

  Fly   145 LSMLISYQRTG----------ELQPKFPFPSVYPWD---NMKLSNYIISYFWNVCAAL-----GV 191
            ..|:.:....|          ||.    :|:.:|:|   |..|....:.|  .|.:.|     |:
  Fly   133 FGMIYALFLFGVFVQVISGNWELL----YPAYFPFDLESNRFLGAVALGY--QVFSMLVEGFQGL 191

  Fly   192 ALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYF 256
            ...|....|| |.|:.:: .|:.|...::.:|:. .|...|:.|....:.:.|.:...:.::...
  Fly   192 GNDTYTPLTL-CLLAGHV-HLWSIRMGQLGYFDD-ETVVNHQRLLDYIEQHKLLVRFHNLVSRTI 253

  Fly   257 RPL-ICQFVAASLHLCVL-CYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQ 319
            ..: :.|.......||:: .|.|.......:|::|..|...|..|:...|:..|.:..|.:....
  Fly   254 SEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPY 318

  Fly   320 AIYESSW 326
            ||:.|.|
  Fly   319 AIFSSRW 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 68/306 (22%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 59/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.