DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or24a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:416 Identity:89/416 - (21%)
Similarity:155/416 - (37%) Gaps:112/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YPWRSICCILSVASFMPLTIA---------FGLQNVQ-NVEQLTDSLCSVLVDLLALCKIGLFLW 85
            ||.:....::.:.||....|.         :|:..:. |:....|:||.|...:|:|.|: :.:|
  Fly    30 YPEQKRTVLVKLWSFFNFFILTYGCYAEAYYGIHYIPINIATALDALCPVASSILSLVKM-VAIW 93

  Fly    86 LYKD--------FKFLIGQ------------FY------------CVLQTETHTAVAEMI--VTR 116
            .|:|        .:||..|            ||            |...|.|..:|..:|  :.|
  Fly    94 WYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTSTSYSVRHLIDNILR 158

  Fly   117 ESRRDQFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISY 181
            .:....:|                          |:.        ||..::|...::|..|.|:|
  Fly   159 RTHGKDWI--------------------------YET--------PFKMMFPDLLLRLPLYPITY 189

  Fly   182 F---WN-----VCAA------LGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETH 232
            .   |:     ||..      ||..|....:  |.| |..::|.|.::...:....|....:...
  Fly   190 ILVHWHGYITVVCFVGADGFFLGFCLYFTVL--LLC-LQDDVCDLLEVENIEKSPSEAEEARIVR 251

  Fly   233 ENLKHV---FQLYALCLNLGHFLNEYFRPLICQFVAASLHL--CVLCYQLSANILQPALLFYAAF 292
            |..|.|   .::..|...|...:.|.   .:..||.:||.:  .|:...|.:.:   .::.|..:
  Fly   252 EMEKLVDRHNEVAELTERLSGVMVEI---TLAHFVTSSLIIGTSVVDILLFSGL---GIIVYVVY 310

  Fly   293 TAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSW-PHLLQENLQLVSSLKIAMMRSSLGCPIDGY 356
            |.||..::.:||..||.|...|....::.:.|.| .|.::  :|.::.|.:|..:..|...|.  
  Fly   311 TCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVR--VQKMTLLMVARAQRVLTIKIP-- 371

  Fly   357 FFEANRETLITIVRTAISYVTLLRSL 382
            ||..:.|||.:|:|...|.:.|.:|:
  Fly   372 FFSPSLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 80/366 (22%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 80/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.