DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or22c

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:415 Identity:82/415 - (19%)
Similarity:165/415 - (39%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTDKFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFMPLT------IAFGLQNVQNV 60
            :.|.|.|:......::||.....:..|.| ||.:  .:|.|.:|..:.      :::|..::.|:
  Fly     9 IADHFYRIPRISGLIVGLWPQRIRGGGGR-PWHA--HLLFVFAFAMVVVGAVGEVSYGCVHLDNL 70

  Fly    61 EQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIV---TRESRRDQ 122
            ....::.|......:.:.|:.:|....:.:..|:.:...:|..........|:|   |..:|...
  Fly    71 VVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSL 135

  Fly   123 FISAMYAYCFITAGLSACLMSPLSMLISYQRTGEL--QPKFPF----------PSVYPWDNMKLS 175
            .:.:..     ||..:|..:.||.|.: |:...:|  |.:.||          |.|:|      .
  Fly   136 LLLSSG-----TATNAAFTLQPLIMGL-YRWIVQLPGQTELPFNIILPSFAVQPGVFP------L 188

  Fly   176 NYIISYFWNVCAALGVALPTVCVDTLF-CSLSHNLCALFQIARHKM------MHFEGRN--TKET 231
            .|::......|.....:.    ||..| ||..: :|..|::.:..:      :|.:..:  |:|.
  Fly   189 TYVLLTASGACTVFAFSF----VDGFFICSCLY-ICGAFRLVQQDIRRIFADLHGDSVDVFTEEM 248

  Fly   232 HENLKH----VFQLYALCLNLGHFLNEYFRPLI-CQFVAASLHLCVLCYQLSANILQPALLFYAA 291
            :..::|    |.:.:...::....|...|..:: ..|::|:..||.....:..|....:.|.|..
  Fly   249 NAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYIC 313

  Fly   292 FTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSSLGCPIDGY 356
            :..|.:.|:.:|||.|:.:..........:|:..|........:::..:   :.||.....|...
  Fly   314 YIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKVILMI---LRRSQRAKTIAVP 375

  Fly   357 FFEANRETLITIVRTAISYVTLLRS 381
            ||..:...|.:|:.||.||:|||::
  Fly   376 FFTPSLPALRSILSTAGSYITLLKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 62/341 (18%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 63/342 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.